Clone MIP05859 Report

Search the DGRC for MIP05859

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:58
Well:59
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42853-RA
Protein status:MIP05859.pep: gold
Sequenced Size:1018

Clone Sequence Records

MIP05859.complete Sequence

1018 bp assembled on 2009-02-23

GenBank Submission: BT066309.1

> MIP05859.complete
TTTTTGTAATTTGTATATCTTCTCAGTACTAAAGGTCTTAAAAACTCAAA
AAAAAAAAAAATATGGCCACAAGCGCGAACTCTGTTCAAGTTTCTGGAGC
CGGTGCGGAGGTAAACGAAGCTAAACTCATCTGCATCTGGGAGGGAATAA
CTGAGCTGATCCTGTGGCGCAACTGGATAAAGTCGATGCTTGTATTCGTA
ATGCTACAGACCATAATTTATGATCTGCTTTCTGAACCGCTTGTGTTCGT
GGTGAGCGTATGGGCTTTGATTATCATGGTCATATCAATGGGGTACCGTT
TTTTGGTACAGTACACTAATACCCATATCCAGAACAACAGCTATCCGAAA
TATCTTGACATAGACCTAAGAATCTCCCAGGAGTTATCTAAGCAACTGGG
TGTTCTAGTTTCAACCAAAGTTGTTGCGTTTCTAAATAATCTACGAGAGA
TATTACTAGTAAAGAGCTTTTCGAAATCATTCAAGTGGTTTGGCCTTCTC
CTAATAATTAGCAAACTTGGAAAGCAGATTAACTTTCTAATTGTTGGCCA
ATTAGGGCTGTTTCTACTCTTCACAATTCCCAAAATGTGTGAGATGAATA
GACGTTCATCAAATATTGTACAACTTCCTAAATTTAATAAACAATATCAA
ATTACCAAAGTAAACGCTTCGACCGAAACCCAGAATGCATTGGACATGGA
ATCCTTAAAAGAGTGCAACGAGGACACCATAAAGCTAATTGAAAAGCAAC
CAGAAGGGATGGATCTCTCACTCGGCTGTGATATTACCAAGGAATCCCAG
AATGCGGCTGATGATCTTAAAGCCTTTAAAGTAAAGGAGGAAATAGACAT
TGATGCTTTTGAGCGACTTGCCGATTCCTGGTCCGACGAAGATACACTTA
CTGATCAAAAAAATTAATTCAAGACAATTCAAATAATTTATTTTTATATA
TTGTGAAGCGTTTGGATAAATAAAACTCCTAGGGGCACTGTGCGGAACAA
CAAAAAAAAAAAAAAAAA

MIP05859.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:58
Subject Length Description Subject Range Query Range Score Percent Strand
MB7.chr3L.pasa.9032.a 1060 MB7.chr3L.pasa.9032.a 66..1060 1..995 4975 100 Plus
CG7341-RA 1434 CG7341-RA 1358..1434 1002..926 385 100 Minus
CG7341-RB 1453 CG7341-RB 1377..1453 1002..926 385 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:33:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18111115..18111670 556..1 2750 99.6 Minus
chr3L 24539361 chr3L 18110613..18111060 1001..554 2210 99.6 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG42853-RA 855 CG42853-PA 1..855 63..917 4275 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:05:41 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG42853-RA 1001 CG42853-RA 1..1001 1..1001 5005 100 Plus
CG7341-RB 1455 CG7341-RB 1384..1455 1001..930 360 100 Minus
CG7341-RA 1436 CG7341-RA 1365..1436 1001..930 360 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:33:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42853-PA 284 CG42853-PA 1..284 63..914 1433 100 Plus
Rtnl2-PC 255 CG1279-PC 15..226 135..782 182 25.9 Plus
Rtnl2-PB 255 CG1279-PB 15..226 135..782 182 25.9 Plus
Rtnl1-PL 222 CG33113-PL 7..182 93..608 150 25 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:33:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18121434..18121989 556..1 2780 100 Minus
3L 28110227 3L 18120931..18121379 1002..554 2245 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18114534..18115089 556..1 2780 100 Minus
3L 28103327 3L 18114031..18114479 1002..554 2245 100 Minus
Blast to na_te.dros performed 2014-11-27 13:33:34
Subject Length Description Subject Range Query Range Score Percent Strand
Max-element 8556 Max-element DME487856 8556bp Derived from AJ487856 (Rel. 71, Last updated, Version 1). 1029..1088 954..896 117 68.3 Minus

MIP05859.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:36:51 Download gff for MIP05859.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18111116..18111670 1..555 99   Minus
chr3L 18110613..18111058 556..1001 94 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:31 Download gff for MIP05859.complete
Subject Subject Range Query Range Percent Splice Strand
CG42853-RA 1..855 63..917 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:43:46 Download gff for MIP05859.complete
Subject Subject Range Query Range Percent Splice Strand
CG42853-RA 1..855 63..917 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:36:51 Download gff for MIP05859.complete
Subject Subject Range Query Range Percent Splice Strand
CG42853-RA 1..855 63..917 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-23 18:53:10 Download gff for MIP05859.complete
Subject Subject Range Query Range Percent Splice Strand
CG7341-RB 1378..1453 926..1001 100   Minus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:31 Download gff for MIP05859.complete
Subject Subject Range Query Range Percent Splice Strand
CG42853-RA 1..1001 1..1001 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:43:46 Download gff for MIP05859.complete
Subject Subject Range Query Range Percent Splice Strand
CG42853-RA 1..1001 1..1001 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:36:51 Download gff for MIP05859.complete
Subject Subject Range Query Range Percent Splice Strand
CG42853-RA 1..1001 1..1001 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:36:51 Download gff for MIP05859.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18121435..18121989 1..555 100   Minus
3L 18120932..18121377 556..1001 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:43:46 Download gff for MIP05859.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18114535..18115089 1..555 100   Minus
arm_3L 18114032..18114477 556..1001 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:18 Download gff for MIP05859.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18114535..18115089 1..555 100   Minus
3L 18114032..18114477 556..1001 100 <- Minus

MIP05859.pep Sequence

Translation from 62 to 916

> MIP05859.pep
MATSANSVQVSGAGAEVNEAKLICIWEGITELILWRNWIKSMLVFVMLQT
IIYDLLSEPLVFVVSVWALIIMVISMGYRFLVQYTNTHIQNNSYPKYLDI
DLRISQELSKQLGVLVSTKVVAFLNNLREILLVKSFSKSFKWFGLLLIIS
KLGKQINFLIVGQLGLFLLFTIPKMCEMNRRSSNIVQLPKFNKQYQITKV
NASTETQNALDMESLKECNEDTIKLIEKQPEGMDLSLGCDITKESQNAAD
DLKAFKVKEEIDIDAFERLADSWSDEDTLTDQKN*

MIP05859.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 16:35:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10829-PA 294 GF10829-PA 25..284 24..276 329 33.7 Plus
Dana\GF17296-PA 259 GF17296-PA 17..232 27..263 186 24.9 Plus
Dana\GF14162-PA 596 GF14162-PA 401..557 29..182 150 26.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 16:35:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15756-PA 68 GG15756-PA 1..68 212..284 210 65.8 Plus
Dere\GG25105-PA 246 GG25105-PA 3..196 29..217 170 27.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 16:35:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17123-PA 245 GH17123-PA 4..162 31..185 151 34 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 16:35:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG42853-PA 284 CG42853-PA 1..284 1..284 1433 100 Plus
Rtnl2-PC 255 CG1279-PC 15..226 25..240 182 25.9 Plus
Rtnl2-PB 255 CG1279-PB 15..226 25..240 182 25.9 Plus
Rtnl1-PL 222 CG33113-PL 7..182 11..182 150 25 Plus
Rtnl1-PG 224 CG33113-PG 26..184 27..182 146 25.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 16:35:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11728-PA 258 GI11728-PA 15..162 32..175 172 30.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 16:35:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12168-PA 319 GL12168-PA 29..183 32..180 212 30.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 16:35:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11813-PB 321 GA11813-PB 29..183 32..180 212 30.3 Plus
Dpse\GA11813-PA 298 GA11813-PA 6..160 32..180 211 30.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 16:35:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10472-PA 238 GM10472-PA 6..215 32..240 178 25.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 16:35:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19473-PA 238 GD19473-PA 6..215 32..240 169 26.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 16:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11400-PA 265 GJ11400-PA 15..212 26..214 214 30.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 16:35:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11074-PA 247 GK11074-PA 19..181 32..191 188 32.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 16:35:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25782-PA 264 GE25782-PA 15..171 25..177 162 29.8 Plus

MIP05859.hyp Sequence

Translation from 62 to 916

> MIP05859.hyp
MATSANSVQVSGAGAEVNEAKLICIWEGITELILWRNWIKSMLVFVMLQT
IIYDLLSEPLVFVVSVWALIIMVISMGYRFLVQYTNTHIQNNSYPKYLDI
DLRISQELSKQLGVLVSTKVVAFLNNLREILLVKSFSKSFKWFGLLLIIS
KLGKQINFLIVGQLGLFLLFTIPKMCEMNRRSSNIVQLPKFNKQYQITKV
NASTETQNALDMESLKECNEDTIKLIEKQPEGMDLSLGCDITKESQNAAD
DLKAFKVKEEIDIDAFERLADSWSDEDTLTDQKN*

MIP05859.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:09:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG42853-PA 284 CG42853-PA 1..284 1..284 1433 100 Plus
Rtnl2-PC 255 CG1279-PC 15..226 25..240 182 25.9 Plus
Rtnl2-PB 255 CG1279-PB 15..226 25..240 182 25.9 Plus
Rtnl1-PL 222 CG33113-PL 7..182 11..182 150 25 Plus
Rtnl1-PG 224 CG33113-PG 26..184 27..182 146 25.2 Plus