Clone MIP05887 Report

Search the DGRC for MIP05887

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:58
Well:87
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptSfp78E-RA
Protein status:MIP05887.pep: gold
Sequenced Size:778

Clone Sequence Records

MIP05887.complete Sequence

778 bp assembled on 2009-02-25

GenBank Submission: BT070220.1

> MIP05887.complete
CCCAATTTGCAGGGGTGTATCTTTGTTCTGTGGAACACACACATTACACA
TTAGGCTGATCCAATACATCAGCAGACTTGTTTGAATCAATCAGTCATAG
AGGAAAACTGCATCAGCAAGGTTGAGCTATGAATATCTTTATCTCCTTAA
TATTGGTAGTGCTGGCCATTTTATCTTTTGCTGACCACACCGTGGCAGAC
GGAGATCGGCACCTAAATGAGGACTTAAATCGAGCGACGGTAAAGAAGAC
TAAGTATGGTTGGCAATGTGCCGGGGTGACGTGCCCCATAAAGTTTACGG
CATCTTGTAAGGTAACAAAGGTCCTAAAGCCCTCTGATCTACAGCACACT
GAGCTCCTGATTTTGTGCATGGATAAAAACGATAAGCCTATGTGTGGGAT
AACACGAACTCGAAAAGGGGTAATACAGGAAGTTCTGGACGTGGATGAAA
ACGGAAATACGATATATGACAAAAAGGAAGTTATTTCGGAGAACGATGGT
ACTAAAATCCCTAGGTGCCCACGAAAGTAAATGATGTGCACTGATCGACT
TCACACAAATATGTTTTATCTACACAAGGTTTTTAACTTTAAATGTTATG
GACTATAAAAATAATTACACATTTTTGTGGCAACCAACAATGGTTTATAT
ATCTTGTAGAAAAAATATTGGTATAGTTTGGCAATTAGTATGTATATAGA
ATTGGTGAAACTAACAGAATGCGTTACACATAAATAAAGATAACGAACAC
AAAAGACAACAAAAAAAAAAAAAAAAAA

MIP05887.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:25:16
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp78E-RA 778 Sfp78E-RA 19..778 1..760 3800 100 Plus
CG11248-RB 2927 CG11248-RB 2779..2927 768..620 730 99.3 Minus
CG11248-RA 2998 CG11248-RA 2850..2998 768..620 730 99.3 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:21:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21672034..21672538 760..256 2525 100 Minus
chr3L 24539361 chr3L 21672712..21672900 195..7 945 100 Minus
chr3L 24539361 chr3L 21672601..21672662 255..194 310 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:21:12
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp78E-RA 402 CG42607-PA 1..402 129..530 2010 100 Plus
Sfp78E-RB 453 CG42607-PB 117..453 194..530 1685 100 Plus
Sfp78E-RB 453 CG42607-PB 1..67 129..195 335 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:05:45 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:21:11
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp78E-RA 778 CG42607-RA 19..778 1..760 3800 100 Plus
Sfp78E-RB 805 CG1-RB 239..805 194..760 2835 100 Plus
Sfp78E-RB 805 CG1-RB 1..189 7..195 945 100 Plus
CG11248-RC 2998 CG11248-RC 2865..2998 760..627 670 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:21:13
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp78E-PA 133 CG42607-PA 19..133 183..527 622 100 Plus
Sfp78E-PB 150 CG42607-PB 40..150 195..527 599 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:21:09
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21683090..21683602 768..256 2550 99.8 Minus
3L 28110227 3L 21683776..21683964 195..7 945 100 Minus
3L 28110227 3L 21683665..21683726 255..194 310 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:42:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21676190..21676702 768..256 2550 99.8 Minus
3L 28103327 3L 21676876..21677064 195..7 945 100 Minus
3L 28103327 3L 21676765..21676826 255..194 310 100 Minus
Blast to na_te.dros performed on 2014-11-27 05:21:10 has no hits.

MIP05887.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:30:54 Download gff for MIP05887.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21672713..21672905 1..194 98   Minus
chr3L 21672601..21672661 195..255 100 <- Minus
chr3L 21672034..21672538 256..760 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:57 Download gff for MIP05887.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp78E-RA 1..402 129..530 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:22:30 Download gff for MIP05887.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp78E-RA 1..402 129..530 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:30:54 Download gff for MIP05887.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp78E-RA 1..402 129..530 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-25 16:57:49 Download gff for MIP05887.complete
Subject Subject Range Query Range Percent Splice Strand
CG11248-RA 2802..2935 627..760 100   Minus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:57 Download gff for MIP05887.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp78E-RA 19..778 1..760 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:22:30 Download gff for MIP05887.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp78E-RA 19..778 1..760 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:30:54 Download gff for MIP05887.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp78E-RA 19..778 1..760 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:30:54 Download gff for MIP05887.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21683777..21683969 1..194 98   Minus
3L 21683665..21683725 195..255 100 <- Minus
3L 21683098..21683602 256..760 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:22:30 Download gff for MIP05887.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21676877..21677069 1..194 98   Minus
arm_3L 21676765..21676825 195..255 100 <- Minus
arm_3L 21676198..21676702 256..760 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:50 Download gff for MIP05887.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21676877..21677069 1..194 98   Minus
3L 21676765..21676825 195..255 100 <- Minus
3L 21676198..21676702 256..760 100 <- Minus

MIP05887.pep Sequence

Translation from 128 to 529

> MIP05887.pep
MNIFISLILVVLAILSFADHTVADGDRHLNEDLNRATVKKTKYGWQCAGV
TCPIKFTASCKVTKVLKPSDLQHTELLILCMDKNDKPMCGITRTRKGVIQ
EVLDVDENGNTIYDKKEVISENDGTKIPRCPRK*

MIP05887.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 16:29:36
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp78E-PA 133 CG42607-PA 1..133 1..133 701 100 Plus
Sfp78E-PB 150 CG42607-PB 1..150 1..133 673 88.7 Plus

MIP05887.hyp Sequence

Translation from 128 to 529

> MIP05887.hyp
MNIFISLILVVLAILSFADHTVADGDRHLNEDLNRATVKKTKYGWQCAGV
TCPIKFTASCKVTKVLKPSDLQHTELLILCMDKNDKPMCGITRTRKGVIQ
EVLDVDENGNTIYDKKEVISENDGTKIPRCPRK*

MIP05887.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:51:50
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp78E-PA 133 CG42607-PA 1..133 1..133 701 100 Plus
Sfp78E-PB 150 CG42607-PB 1..150 1..133 673 88.7 Plus