Clone MIP05930 Report

Search the DGRC for MIP05930

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:59
Well:30
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCyp313a1-RA
Protein status:MIP05930.pep: gold
Sequenced Size:1633

Clone Sequence Records

MIP05930.complete Sequence

1633 bp assembled on 2009-02-21

GenBank Submission: BT066311.1

> MIP05930.complete
AAACCATTCTATAGCGAATATAATTCATCGAAGTGACAGTTCTATTATGT
TAACTATCAATTTGTTACTGGCGGTCGGAGCTCTTTTTTGGATTTATTTC
TTATGGAGTCGCCGAAGGTTATATTTCCTGATGCTAAAGATTCCCGGACC
CATAGGACTACCCATTTTGGGTAGCTCCCTGGAAAATATCATCACCTATA
AACGTAAACTAAGCTTTCGAACAAAGTATTTGAATAAGTACGGCTCGACT
ATTTTAACGTGGATGGGTCCGGTGCCATTTATAGTGACACGAGATCCGAA
AGTCGTTGAGGATATCTTTTCGTCTCCTGATTGCCACAACAAGAGCCAGC
ATATTGTGAATGCCATAACTTCTTGTATGGGAAATGGATTGCTGGGAAAA
CAAGATCCTCATTGGCTTGATCGCCGCAAGCACTTTAACCCATCGTTTAA
ACAGGATCTTTTGCTTAGCTTCTTTCACATTTTCGATGCCGAGACGAAAG
TCCTGATGAATTTACTAGATACTTATGTCGACAAAGGCGAAATAGATGTG
GTTCCAGAGATGCTTAGATGGTCTTTTAAAATAGCCGCCCAAACCACAAT
GGGTTCTGAAGTTAAACATGATGAGCACTTCAAAAATGGCAGCCTCGTGG
AAAGCTTCGAATCGCTCATATCTCATTCGACTCTCAATATATTGATGCCC
TTGGTTCAAAACAGGATGATTTCAAAAATATGCGGTTATGATAAGTTACG
AGCTGACAACTTTTCTAGAATTCAAAAAATGTTGGACAACGTGGTTAATA
AAAAAGTCAATCCATTGCCAAAGACTGATTCAGATCCCGAATCGAACATT
GTGATCAATAGGGCAATGGAACTGTACCGTAAAGGCGATATCACCTATAT
GGATGTGAAGAGCGAATGTTGTATAATGATTGCCGCCGGCTATGATACAT
CAGCTCTAACAGTTTATCACGCACTCTTCCTACTGGCCAATCATCCCGAG
CACCAGGAAGCGGTCTTTGAGGAGCTAAATGGTGTCTTCCCAGATGCCGG
ACACTTTGGAATAACATACCCAGATATGCAGAAACTGGACTACTTGGAGC
GCGTGATAAAGGAGACACTACGCCTGATACCTGCTATTCCAATAACAGCA
AGGGAAACAAAGAATGATGTTCGTCTCTCGAATGGAGTTCTCATTCCCAA
AGGAGTCGTCATCGGCATCGACATGTTTCACACTCACAGAAATCCCGAAG
TCTGGGGACCAGATGCAGACAACTTTAATCCGGATAACTTCTTGGCGGAA
AACATGGAACAAAAGCACCCATATGCCTACATTCCATTTGCGAGGGGAAA
GAGAAATTGCATTGGGTCAAAATATGCAATGATGTCTTCAAAGTTTGCCT
TATGCAGAATACTCAGGAACTACAAGATTAGCACAAGCACTCTCTACAAG
GATCTGGTTTATGTGGACAACATGACCATGAAACTGGCTGAGTATCCTCG
ACTTAAACTTCAACGACGCGGTTAGGTTTCTATAACAATTAGGGAATAAT
ACAATAAGATATTATCGAAAATAAATATTTTTACTGCTGAGAAAATAAAA
CAAATACTAATAATTAAAAAAAAAAAAAAAAAA

MIP05930.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp313a1-RA 1632 Cyp313a1-RA 9..1626 1..1618 8090 100 Plus
Cyp313a1.a 1609 Cyp313a1.a 421..1609 403..1591 5945 100 Plus
Cyp313a1.a 1609 Cyp313a1.a 9..412 1..404 2020 100 Plus
Cyp313a3-RA 1742 Cyp313a3-RA 270..411 194..335 170 74.6 Plus
Cyp313a3-RA 1742 Cyp313a3-RA 1391..1511 1315..1435 140 74.3 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:13:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10346929..10347503 791..1365 2875 100 Plus
chr3R 27901430 chr3R 10347569..10347820 1364..1615 1260 100 Plus
chr3R 27901430 chr3R 10345813..10346020 1..208 1040 100 Plus
chr3R 27901430 chr3R 10346094..10346294 204..404 1005 100 Plus
chr3R 27901430 chr3R 10346357..10346544 403..590 940 100 Plus
chr3R 27901430 chr3R 10346752..10346887 664..799 650 98.5 Plus
chr3R 27901430 chr3R 10346606..10346679 591..664 370 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:13:44
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp313a1-RA 1479 CG3360-PA 1..1479 47..1525 7395 100 Plus
Cyp313a2-RB 1482 CG10094-PB 1135..1380 1181..1426 240 73.2 Plus
Cyp313a3-RA 1479 CG10093-PA 39..289 85..335 190 71.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:05:53 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:13:43
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp313a1-RA 1623 CG3360-RA 9..1623 1..1615 8075 100 Plus
Cyp313a2-RB 1577 CG10094-RB 1140..1385 1181..1426 240 73.2 Plus
Cyp313a3-RA 1777 CG10093-RA 196..446 85..335 190 71.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:13:46
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp313a1-PA 492 CG3360-PA 1..492 47..1522 2595 100 Plus
Cyp313a3-PA 492 CG10093-PA 1..491 47..1519 1443 53.6 Plus
Cyp313a2-PB 493 CG10094-PB 1..491 47..1519 1334 48.5 Plus
Cyp313a5-PA 487 CG15807-PA 1..486 47..1519 1201 45.8 Plus
Cyp313a4-PA 494 CG6802-PA 1..493 47..1519 1085 41.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:13:41
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14522173..14522747 791..1365 2875 100 Plus
3R 32079331 3R 14522813..14523067 1364..1618 1275 100 Plus
3R 32079331 3R 14521057..14521264 1..208 1040 100 Plus
3R 32079331 3R 14521338..14521538 204..404 1005 100 Plus
3R 32079331 3R 14521601..14521788 403..590 940 100 Plus
3R 32079331 3R 14521996..14522131 664..799 650 98.5 Plus
3R 32079331 3R 14521850..14521923 591..664 370 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14263004..14263578 791..1365 2875 100 Plus
3R 31820162 3R 14263644..14263898 1364..1618 1275 100 Plus
3R 31820162 3R 14261888..14262095 1..208 1040 100 Plus
3R 31820162 3R 14262169..14262369 204..404 1005 100 Plus
3R 31820162 3R 14262432..14262619 403..590 940 100 Plus
3R 31820162 3R 14262827..14262962 664..799 650 98.5 Plus
3R 31820162 3R 14262681..14262754 591..664 370 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:13:42 has no hits.

MIP05930.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:07:50 Download gff for MIP05930.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10347570..10347820 1365..1615 100   Plus
chr3R 10346929..10347502 791..1364 100 -> Plus
chr3R 10346752..10346878 664..790 100 -> Plus
chr3R 10346606..10346678 591..663 100 -> Plus
chr3R 10346359..10346544 405..590 100 -> Plus
chr3R 10346094..10346294 204..404 100 -> Plus
chr3R 10345813..10346015 1..203 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:17 Download gff for MIP05930.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp313a1-RA 1..1479 47..1525 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:07 Download gff for MIP05930.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp313a1-RA 1..1479 47..1525 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:47:55 Download gff for MIP05930.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp313a1-RA 1..1479 47..1525 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:07:50 Download gff for MIP05930.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp313a1-RA 1..1479 47..1525 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-21 14:35:24 Download gff for MIP05930.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp313a1-RA 1..1511 15..1525 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:07 Download gff for MIP05930.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp313a1-RA 9..1623 1..1615 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:47:55 Download gff for MIP05930.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp313a1-RA 9..1623 1..1615 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:07:50 Download gff for MIP05930.complete
Subject Subject Range Query Range Percent Splice Strand
Cyp313a1-RA 9..1623 1..1615 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:07:50 Download gff for MIP05930.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14522814..14523064 1365..1615 100   Plus
3R 14522173..14522746 791..1364 100 -> Plus
3R 14521996..14522122 664..790 100 -> Plus
3R 14521850..14521922 591..663 100 -> Plus
3R 14521603..14521788 405..590 100 -> Plus
3R 14521338..14521538 204..404 100 -> Plus
3R 14521057..14521259 1..203 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:47:55 Download gff for MIP05930.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10348536..10348786 1365..1615 100   Plus
arm_3R 10347895..10348468 791..1364 100 -> Plus
arm_3R 10347718..10347844 664..790 100 -> Plus
arm_3R 10347572..10347644 591..663 100 -> Plus
arm_3R 10347325..10347510 405..590 100 -> Plus
arm_3R 10347060..10347260 204..404 100 -> Plus
arm_3R 10346779..10346981 1..203 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:10:51 Download gff for MIP05930.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14263645..14263895 1365..1615 100   Plus
3R 14263004..14263577 791..1364 100 -> Plus
3R 14262827..14262953 664..790 100 -> Plus
3R 14262681..14262753 591..663 100 -> Plus
3R 14262434..14262619 405..590 100 -> Plus
3R 14262169..14262369 204..404 100 -> Plus
3R 14261888..14262090 1..203 100 -> Plus

MIP05930.hyp Sequence

Translation from 0 to 1524

> MIP05930.hyp
NHSIANIIHRSDSSIMLTINLLLAVGALFWIYFLWSRRRLYFLMLKIPGP
IGLPILGSSLENIITYKRKLSFRTKYLNKYGSTILTWMGPVPFIVTRDPK
VVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQDPHWLDRRKHFNPSFK
QDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFKIAAQTTM
GSEVKHDEHFKNGSLVESFESLISHSTLNILMPLVQNRMISKICGYDKLR
ADNFSRIQKMLDNVVNKKVNPLPKTDSDPESNIVINRAMELYRKGDITYM
DVKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAG
HFGITYPDMQKLDYLERVIKETLRLIPAIPITARETKNDVRLSNGVLIPK
GVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQKHPYAYIPFARGK
RNCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKLAEYPR
LKLQRRG*

MIP05930.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:31:02
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp313a1-PA 492 CG3360-PA 1..492 16..507 2595 100 Plus
Cyp313a3-PA 492 CG10093-PA 1..491 16..506 1443 53.6 Plus
Cyp313a2-PB 493 CG10094-PB 1..491 16..506 1334 48.5 Plus
Cyp313a5-PA 487 CG15807-PA 1..486 16..506 1201 45.8 Plus
Cyp313a4-PA 494 CG6802-PA 1..493 16..506 1085 41.5 Plus

MIP05930.pep Sequence

Translation from 1 to 1524

> MIP05930.pep
NHSIANIIHRSDSSIMLTINLLLAVGALFWIYFLWSRRRLYFLMLKIPGP
IGLPILGSSLENIITYKRKLSFRTKYLNKYGSTILTWMGPVPFIVTRDPK
VVEDIFSSPDCHNKSQHIVNAITSCMGNGLLGKQDPHWLDRRKHFNPSFK
QDLLLSFFHIFDAETKVLMNLLDTYVDKGEIDVVPEMLRWSFKIAAQTTM
GSEVKHDEHFKNGSLVESFESLISHSTLNILMPLVQNRMISKICGYDKLR
ADNFSRIQKMLDNVVNKKVNPLPKTDSDPESNIVINRAMELYRKGDITYM
DVKSECCIMIAAGYDTSALTVYHALFLLANHPEHQEAVFEELNGVFPDAG
HFGITYPDMQKLDYLERVIKETLRLIPAIPITARETKNDVRLSNGVLIPK
GVVIGIDMFHTHRNPEVWGPDADNFNPDNFLAENMEQKHPYAYIPFARGK
RNCIGSKYAMMSSKFALCRILRNYKISTSTLYKDLVYVDNMTMKLAEYPR
LKLQRRG*

MIP05930.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 16:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17735-PA 492 GF17735-PA 1..490 16..506 1408 51.1 Plus
Dana\GF17731-PA 778 GF17731-PA 1..475 16..493 1329 51 Plus
Dana\GF17734-PA 553 GF17734-PA 101..553 55..506 1148 46 Plus
Dana\GF17876-PA 482 GF17876-PA 21..481 36..506 1008 40.8 Plus
Dana\GF16333-PA 501 GF16333-PA 16..501 31..506 702 31.4 Plus
Dana\GF17734-PA 553 GF17734-PA 18..118 33..134 199 48 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 16:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16858-PA 492 GG16858-PA 1..491 16..506 2375 90.4 Plus
Dere\GG17145-PA 492 GG17145-PA 1..491 16..506 1528 54.4 Plus
Dere\GG17146-PA 493 GG17146-PA 1..491 16..506 1464 50.7 Plus
Dere\GG17148-PA 488 GG17148-PA 1..487 16..506 1233 45.4 Plus
Dere\GG17107-PA 494 GG17107-PA 21..493 36..506 1067 41.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 16:41:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19591-PA 491 GH19591-PA 1..490 16..506 1109 40.7 Plus
Dgri\GH15389-PA 492 GH15389-PA 16..491 29..506 1031 41.2 Plus
Dgri\GH17317-PA 490 GH17317-PA 1..488 16..506 970 38 Plus
Dgri\GH22919-PA 503 GH22919-PA 1..503 16..506 687 30.5 Plus
Dgri\GH14221-PA 542 GH14221-PA 29..541 17..506 542 29.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 16:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
Cyp313a1-PA 492 CG3360-PA 1..492 16..507 2595 100 Plus
Cyp313a3-PA 492 CG10093-PA 1..491 16..506 1443 53.6 Plus
Cyp313a2-PB 493 CG10094-PB 1..491 16..506 1334 48.5 Plus
Cyp313a5-PA 487 CG15807-PA 1..486 16..506 1201 45.8 Plus
Cyp313a4-PA 494 CG6802-PA 1..493 16..506 1085 41.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 16:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22266-PA 481 GI22266-PA 1..479 16..506 1047 41.9 Plus
Dmoj\GI10234-PA 518 GI10234-PA 1..518 16..506 684 30.9 Plus
Dmoj\GI22127-PA 533 GI22127-PA 32..532 21..506 542 29.2 Plus
Dmoj\GI11123-PA 552 GI11123-PA 27..546 22..506 487 27.9 Plus
Dmoj\GI18674-PA 506 GI18674-PA 1..476 15..476 475 29.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 16:41:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21563-PA 493 GL21563-PA 1..492 16..506 1323 48.1 Plus
Dper\GL21562-PA 493 GL21562-PA 1..492 16..506 1232 46.7 Plus
Dper\GL27339-PA 475 GL27339-PA 1..474 16..506 1074 41.1 Plus
Dper\GL27338-PA 490 GL27338-PA 1..489 16..506 1057 41.6 Plus
Dper\GL24504-PA 502 GL24504-PA 5..502 13..506 696 31.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 16:41:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26335-PA 493 GA26335-PA 1..492 16..506 1330 48.5 Plus
Dpse\GA26334-PA 493 GA26334-PA 1..492 16..506 1219 46.7 Plus
Dpse\GA27042-PA 491 GA27042-PA 1..490 16..506 1096 41.3 Plus
Dpse\GA19872-PA 490 GA19872-PA 1..489 16..506 1051 41.4 Plus
Dpse\GA21985-PA 502 GA21985-PA 5..502 13..506 691 31.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 16:41:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24167-PA 492 GM24167-PA 1..492 16..507 2507 95.7 Plus
Dsec\GM26028-PA 492 GM26028-PA 1..491 16..506 1488 53 Plus
Dsec\GM26029-PA 494 GM26029-PA 1..492 16..506 1360 48.2 Plus
Dsec\GM25991-PA 492 GM25991-PA 1..491 16..506 1119 42.1 Plus
Dsec\GM26333-PA 503 GM26333-PA 3..503 13..506 640 30.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 16:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18964-PA 492 GD18964-PA 1..492 16..507 2513 95.9 Plus
Dsim\GD20586-PA 492 GD20586-PA 1..491 16..506 1489 52.7 Plus
Dsim\GD20587-PA 495 GD20587-PA 1..494 16..506 1390 49.4 Plus
Dsim\GD20551-PA 494 GD20551-PA 1..493 16..506 1127 41.9 Plus
Dsim\GD20858-PA 503 GD20858-PA 3..503 13..506 639 30.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 16:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24057-PA 495 GJ24057-PA 1..494 16..506 1086 41.1 Plus
Dvir\GJ10058-PA 489 GJ10058-PA 1..488 19..506 1053 41.1 Plus
Dvir\GJ11039-PA 515 GJ11039-PA 1..515 16..506 695 30.6 Plus
Dvir\GJ24249-PA 535 GJ24249-PA 32..534 21..506 553 29.6 Plus
Dvir\GJ15981-PA 558 GJ15981-PA 16..552 11..506 499 28.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 16:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13561-PA 475 GK13561-PA 1..474 16..506 1054 41.5 Plus
Dwil\GK11539-PA 722 GK11539-PA 227..720 10..506 1043 40.2 Plus
Dwil\GK11540-PA 580 GK11540-PA 114..579 31..506 914 38.4 Plus
Dwil\GK14074-PA 499 GK14074-PA 5..499 21..506 711 31.5 Plus
Dwil\GK14161-PA 533 GK14161-PA 32..532 21..506 571 29 Plus
Dwil\GK11539-PA 722 GK11539-PA 52..223 197..367 260 33.7 Plus
Dwil\GK11540-PA 580 GK11540-PA 1..80 44..134 160 30.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 16:41:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24239-PA 492 GE24239-PA 1..491 16..506 2376 90.2 Plus
Dyak\GE24535-PA 492 GE24535-PA 1..491 16..506 1460 52.1 Plus
Dyak\GE24536-PA 493 GE24536-PA 1..491 16..506 1451 49.9 Plus
Dyak\GE24537-PA 488 GE24537-PA 1..487 16..506 1256 46 Plus
Dyak\GE24496-PA 494 GE24496-PA 21..493 36..506 1070 41.4 Plus