Clone MIP06029 Report

Search the DGRC for MIP06029

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:60
Well:29
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG12512-RA
Protein status:MIP06029.pep: gold
Sequenced Size:2051

Clone Sequence Records

MIP06029.complete Sequence

2051 bp assembled on 2009-02-21

GenBank Submission: BT066315.1

> MIP06029.complete
GACTGCGGTCGTTCCTAGATTGCCATACAATAGAAACCGAGCGGAACTGA
ATTGAAAACTAATAGTCGTTTTTAGTGAAAAGTGTACCTGTGCATATTAT
GAAAATATAATAAAACAAAACAGCTGTTTATAACAATTAACTGTGATAAG
TGCCAAGATGAACAGCAAGCTGCAGACCATCTCCCGATACATGCTCAGGC
AGAAATGTGCCTTCAACTCGATGCGCAGCATTTCCACCTCGATGCCCAGC
TTGATCAGCCATAAGCATCATATTGGTAAGGATCCCTTGGTATATCGCAC
CATTGGCCAGCAGTTGGAGCTATCTGCTTCGAATTTTGGGGATGTGGAGG
CGATTGTCTCCTGTCACGAGGGCAAGCGGTACAGCTTCAAAAGTTTGCTA
CAGGAAGCGGATGCGCTGGCGGCGGGTTTCCGGAAATTGGGCCTGCAGCC
AGGTGATGCCGTTGGTCTGTGGGCACCTAACTACTTGCACTGGTACTTGG
GCATGATGGGAGCAGCTCGAGCGGGTCTCACCTCGGTGGGTTTGAATCCA
GCTTACCAGGGACCCGAAATAGCCTACTGTCTGAATAAGGTCAATGTGAA
GGCCATCATTGCGCCGGAGACCTTCAAGACGCAGAACTACTATGAGATTT
TGAGAGATATCTGCCCGGAAATCTCAGATGCGGATACTGGCAAGATCCGG
AGTGAGAAGTTTCCGCACCTGCGATCCGTAATCATTGATAGCAACGATAG
CCTGAAGGGTGCCCTGCGCTTCGATGACTTCCTGGACCTGGCCAGCAAAT
CGGAGCGCGAAGAGGTGGCCAAAATGCAGAAGAGCATTCTGCCCGAGTCT
GCGTGCAATATTCAGTTCACATCGGGAACCACTGGCAATCCCAAGGCTGC
CTGTCTTACCCATCACAATTTCGTCAACAATGGCATCCATGTGGGCAATC
GCAACGAACTGGAGGGCGAGAGGATCTGTGTTCAGGTGCCCATGTTCCAT
GCCTTCGGTGTGATCATCTCCATCATGGCTGCTCTGACCAAAGGTGCCAC
CATGGTCCTACCCGCTGCCGGTTTCAGTCCCAAGGACTCGCTGCAAGCCA
TCGTCAATGAAAAGTGTTCGGTGATCCATGGCACACCAACCATGTATGTG
GATTTGGTCAACACGCAAAAGAAGCTACAGGTGCCGCTGGGCAGGATTAA
GAAGGCCGTCACCGGAGGTGCCATTGTATCGCCGCAGCTGATCAAGGATG
TGAGACAGGTTCTCAACGTGGAAGCGGTGCATAGTGTCTATGGCCTGACG
GAAACCACAGCTGTGATCTTCCAATCCTTGCCCGGCGATAGCAGTGATGT
TGTCCTCAACTCAGTTGGCCATCTGACGGATCACATCGAAGCCAAGGTGG
TGGATGCCGAGGGCAGGTGTGTGCCATTTGGACAGCCCGGAGAGCTGTGC
GTCCGCGGATATACCACAATGCTGGGCTACCACGATGATGAGGAGAAAAC
AAAGGAAACCATCGGTAATGATAGGTGGTTGCGCACGGGCGATCAGTTTG
TCCTGGAGGCCAATGGATATGGACGGATTGTGGGTCGCCTAAAGGAGATG
CTCATCCGTGGCGGCGAAAATATATTCCCCAAAGAGATCGAAGACTTTCT
AAACGCCCATCCACAGGTCATTGAGGCGCATGTGATTGGAGTGCCTGATG
AGCGATTGGGTGAAGAAGTCTGCGCCTATGTTCGCCTGGAGGAGGGCGTG
GACCCCGCCTCCTTCACCGCGGAGACCTTAAAGGCCTATGCCAAGGGCAA
GCTGGCCCACTTCAAGGTGCCCAGATATGTGATCCCCATAGATGCATTCC
CTAAAACCACCTCGGGCAAGATCCAGAAATTCAAGCTAGTGGAGGCTTTC
AAGGCCAAGGAAACAGAGCTAAAAGCTGCCAGACTATGAGTAACTTTATA
AATTTAAACAAATACATAAAAATTAAGATTTAATGTCACTAGACGTTAAA
ATATTTAGGTTTAATAAACCTGGTTCCAAATTAAAAAAAAAAAAAAAAAA
A

MIP06029.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG12512-RA 2169 CG12512-RA 138..2169 1..2032 10145 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 00:31:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5338640..5340100 1685..225 7290 99.9 Minus
chr2L 23010047 chr2L 5338231..5338581 2032..1682 1755 100 Minus
chr2L 23010047 chr2L 5341084..5341311 228..1 1140 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG12512-RA 1782 CG12512-PA 1..1782 158..1939 8895 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:08 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:31:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG12512-RA 2054 CG12512-RA 23..2054 1..2032 10145 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:31:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG12512-PA 593 CG12512-PA 1..593 158..1936 3067 100 Plus
pdgy-PC 597 CG9009-PC 101..595 374..1900 456 28.5 Plus
pdgy-PB 597 CG9009-PB 101..595 374..1900 456 28.5 Plus
pdgy-PD 597 CG9009-PD 101..595 374..1900 456 28.5 Plus
pdgy-PA 597 CG9009-PA 101..595 374..1900 456 28.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5339541..5341001 1685..225 7290 99.9 Minus
2L 23513712 2L 5339131..5339482 2033..1682 1760 100 Minus
2L 23513712 2L 5341985..5342212 228..1 1140 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5339541..5341001 1685..225 7290 99.9 Minus
2L 23513712 2L 5339131..5339482 2033..1682 1760 100 Minus
2L 23513712 2L 5341985..5342212 228..1 1140 100 Minus
Blast to na_te.dros performed on 2014-11-27 00:31:53 has no hits.

MIP06029.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:48:07 Download gff for MIP06029.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5341084..5341311 1..228 100   Minus
chr2L 5338644..5340096 229..1681 99 <- Minus
chr2L 5338231..5338581 1682..2032 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:06:19 Download gff for MIP06029.complete
Subject Subject Range Query Range Percent Splice Strand
CG12512-RA 1..1782 158..1939 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:12 Download gff for MIP06029.complete
Subject Subject Range Query Range Percent Splice Strand
CG12512-RA 1..1782 158..1939 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:31:14 Download gff for MIP06029.complete
Subject Subject Range Query Range Percent Splice Strand
CG12512-RA 1..1782 158..1939 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:48:07 Download gff for MIP06029.complete
Subject Subject Range Query Range Percent Splice Strand
CG12512-RA 1..1782 158..1939 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-21 16:12:03 Download gff for MIP06029.complete
Subject Subject Range Query Range Percent Splice Strand
CG12512-RA 138..2076 1..1939 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:11 Download gff for MIP06029.complete
Subject Subject Range Query Range Percent Splice Strand
CG12512-RA 138..2169 1..2032 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:31:14 Download gff for MIP06029.complete
Subject Subject Range Query Range Percent Splice Strand
CG12512-RA 23..2054 1..2032 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:48:07 Download gff for MIP06029.complete
Subject Subject Range Query Range Percent Splice Strand
CG12512-RA 23..2054 1..2032 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:48:07 Download gff for MIP06029.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5341985..5342212 1..228 100   Minus
2L 5339545..5340997 229..1681 99 <- Minus
2L 5339132..5339482 1682..2032 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:31:14 Download gff for MIP06029.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5341985..5342212 1..228 100   Minus
arm_2L 5339545..5340997 229..1681 99 <- Minus
arm_2L 5339132..5339482 1682..2032 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:10:55 Download gff for MIP06029.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5341985..5342212 1..228 100   Minus
2L 5339545..5340997 229..1681 99 <- Minus
2L 5339132..5339482 1682..2032 100 <- Minus

MIP06029.pep Sequence

Translation from 157 to 1938

> MIP06029.pep
MNSKLQTISRYMLRQKCAFNSMRSISTSMPSLISHKHHIGKDPLVYRTIG
QQLELSASNFGDVEAIVSCHEGKRYSFKSLLQEADALAAGFRKLGLQPGD
AVGLWAPNYLHWYLGMMGAARAGLTSVGLNPAYQGPEIAYCLNKVNVKAI
IAPETFKTQNYYEILRDICPEISDADTGKIRSEKFPHLRSVIIDSNDSLK
GALRFDDFLDLASKSEREEVAKMQKSILPESACNIQFTSGTTGNPKAACL
THHNFVNNGIHVGNRNELEGERICVQVPMFHAFGVIISIMAALTKGATMV
LPAAGFSPKDSLQAIVNEKCSVIHGTPTMYVDLVNTQKKLQVPLGRIKKA
VTGGAIVSPQLIKDVRQVLNVEAVHSVYGLTETTAVIFQSLPGDSSDVVL
NSVGHLTDHIEAKVVDAEGRCVPFGQPGELCVRGYTTMLGYHDDEEKTKE
TIGNDRWLRTGDQFVLEANGYGRIVGRLKEMLIRGGENIFPKEIEDFLNA
HPQVIEAHVIGVPDERLGEEVCAYVRLEEGVDPASFTAETLKAYAKGKLA
HFKVPRYVIPIDAFPKTTSGKIQKFKLVEAFKAKETELKAARL*

MIP06029.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 16:40:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15513-PA 595 GF15513-PA 2..592 1..591 2722 83.6 Plus
Dana\GF19420-PA 598 GF19420-PA 94..596 65..581 487 28.6 Plus
Dana\GF16109-PA 545 GF16109-PA 24..540 46..584 354 27.9 Plus
Dana\GF14276-PA 666 GF14276-PA 52..530 53..496 283 22.9 Plus
Dana\GF12739-PA 543 GF12739-PA 51..543 72..588 278 24 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 16:40:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24306-PA 593 GG24306-PA 1..591 1..591 3017 93.6 Plus
Dere\GG19427-PA 597 GG19427-PA 93..595 65..581 451 28.5 Plus
Dere\GG11260-PA 544 GG11260-PA 25..544 47..588 354 27.5 Plus
Dere\GG23906-PA 666 GG23906-PA 52..532 53..498 301 23.7 Plus
Dere\GG20824-PA 543 GG20824-PA 51..543 72..588 287 23.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 16:40:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11457-PA 600 GH11457-PA 2..583 1..582 2426 73.5 Plus
Dgri\GH11952-PA 597 GH11952-PA 93..595 65..581 469 28.8 Plus
Dgri\GH18499-PA 544 GH18499-PA 24..544 46..588 358 27.1 Plus
Dgri\GH18500-PA 544 GH18500-PA 24..544 46..588 348 27.1 Plus
Dgri\GH11132-PA 668 GH11132-PA 38..532 35..496 278 24 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 16:40:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG12512-PA 593 CG12512-PA 1..593 1..593 3067 100 Plus
pdgy-PC 597 CG9009-PC 101..595 73..581 456 28.5 Plus
pdgy-PB 597 CG9009-PB 101..595 73..581 456 28.5 Plus
pdgy-PD 597 CG9009-PD 101..595 73..581 456 28.5 Plus
pdgy-PA 597 CG9009-PA 101..595 73..581 456 28.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 16:40:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21922-PA 598 GI21922-PA 2..598 1..593 2415 71.4 Plus
Dmoj\GI15371-PA 576 GI15371-PA 80..574 73..581 473 28.1 Plus
Dmoj\GI24173-PA 544 GI24173-PA 24..544 46..588 358 27.2 Plus
Dmoj\GI12714-PA 668 GI12714-PA 54..534 53..498 305 24.3 Plus
Dmoj\GI22425-PA 537 GI22425-PA 69..534 87..589 278 24.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 16:40:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25909-PA 594 GL25909-PA 1..584 1..584 2652 80.7 Plus
Dper\GL27076-PA 536 GL27076-PA 62..530 93..577 470 29.4 Plus
Dper\GL23410-PA 544 GL23410-PA 24..544 46..588 351 27.3 Plus
Dper\GL21255-PA 666 GL21255-PA 52..532 53..498 293 23.3 Plus
Dper\GL17419-PA 545 GL17419-PA 51..545 72..588 287 23.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 16:40:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25183-PA 594 GA25183-PA 1..584 1..584 2666 81 Plus
Dpse\GA21474-PA 596 GA21474-PA 68..590 42..577 482 28.4 Plus
Dpse\GA19414-PA 544 GA19414-PA 24..544 46..588 348 27.3 Plus
Dpse\GA18225-PA 666 GA18225-PA 52..532 53..498 291 23.3 Plus
Dpse\GA22173-PA 545 GA22173-PA 51..545 72..588 290 24.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 16:40:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18022-PA 164 GM18022-PA 1..157 1..157 837 96.8 Plus
Dsec\GM18023-PA 113 GM18023-PA 1..112 481..592 577 98.2 Plus
Dsec\GM12014-PA 686 GM12014-PA 170..684 52..581 458 28.5 Plus
Dsec\GM15457-PA 666 GM15457-PA 52..532 53..498 301 23.7 Plus
Dsec\GM15771-PA 543 GM15771-PA 51..543 72..588 285 23.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 16:40:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22652-PA 593 GD22652-PA 1..592 1..592 3101 96.8 Plus
Dsim\GD15826-PA 600 GD15826-PA 93..598 65..581 459 29.6 Plus
Dsim\GD21070-PA 544 GD21070-PA 25..544 47..588 363 28.4 Plus
Dsim\GD23948-PA 666 GD23948-PA 52..532 53..498 301 23.7 Plus
Dsim\GD25247-PA 543 GD25247-PA 51..543 72..588 288 23.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 16:40:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17825-PA 598 GJ17825-PA 2..598 1..593 2426 73.9 Plus
Dvir\GJ16795-PA 593 GJ16795-PA 89..591 65..581 452 27.3 Plus
Dvir\GJ14206-PA 544 GJ14206-PA 24..544 46..588 360 27.6 Plus
Dvir\GJ18165-PA 668 GJ18165-PA 38..534 35..498 290 23.5 Plus
Dvir\GJ18629-PA 544 GJ18629-PA 51..536 72..582 286 23.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 16:40:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15099-PA 588 GK15099-PA 2..583 1..582 2526 76.5 Plus
Dwil\GK19734-PA 854 GK19734-PA 93..598 65..584 481 28.9 Plus
Dwil\GK13972-PA 544 GK13972-PA 24..544 46..588 354 26.8 Plus
Dwil\GK22879-PA 543 GK22879-PA 51..543 72..588 303 24.9 Plus
Dwil\GK15027-PA 666 GK15027-PA 25..532 24..498 294 22.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 16:40:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19001-PA 593 GE19001-PA 1..592 1..592 3019 93.2 Plus
Dyak\GE16079-PA 597 GE16079-PA 93..595 65..581 443 28 Plus
Dyak\GE23452-PA 544 GE23452-PA 25..544 47..588 343 27.2 Plus
Dyak\GE19019-PA 666 GE19019-PA 52..532 53..498 301 23.7 Plus
Dyak\GE13765-PA 543 GE13765-PA 51..543 72..588 288 24.3 Plus

MIP06029.hyp Sequence

Translation from 157 to 1938

> MIP06029.hyp
MNSKLQTISRYMLRQKCAFNSMRSISTSMPSLISHKHHIGKDPLVYRTIG
QQLELSASNFGDVEAIVSCHEGKRYSFKSLLQEADALAAGFRKLGLQPGD
AVGLWAPNYLHWYLGMMGAARAGLTSVGLNPAYQGPEIAYCLNKVNVKAI
IAPETFKTQNYYEILRDICPEISDADTGKIRSEKFPHLRSVIIDSNDSLK
GALRFDDFLDLASKSEREEVAKMQKSILPESACNIQFTSGTTGNPKAACL
THHNFVNNGIHVGNRNELEGERICVQVPMFHAFGVIISIMAALTKGATMV
LPAAGFSPKDSLQAIVNEKCSVIHGTPTMYVDLVNTQKKLQVPLGRIKKA
VTGGAIVSPQLIKDVRQVLNVEAVHSVYGLTETTAVIFQSLPGDSSDVVL
NSVGHLTDHIEAKVVDAEGRCVPFGQPGELCVRGYTTMLGYHDDEEKTKE
TIGNDRWLRTGDQFVLEANGYGRIVGRLKEMLIRGGENIFPKEIEDFLNA
HPQVIEAHVIGVPDERLGEEVCAYVRLEEGVDPASFTAETLKAYAKGKLA
HFKVPRYVIPIDAFPKTTSGKIQKFKLVEAFKAKETELKAARL*

MIP06029.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:48:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG12512-PA 593 CG12512-PA 1..593 1..593 3067 100 Plus
pdgy-PC 597 CG9009-PC 101..595 73..581 456 28.5 Plus
pdgy-PB 597 CG9009-PB 101..595 73..581 456 28.5 Plus
pdgy-PD 597 CG9009-PD 101..595 73..581 456 28.5 Plus
pdgy-PA 597 CG9009-PA 101..595 73..581 456 28.5 Plus