Clone MIP06162 Report

Search the DGRC for MIP06162

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:61
Well:62
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42847-RA
Protein status:MIP06162.pep: gold
Sequenced Size:796

Clone Sequence Records

MIP06162.complete Sequence

796 bp assembled on 2009-02-20

GenBank Submission: BT064655.1

> MIP06162.complete
CTAAATACTTACAAAATTTTGTTTTCCATTGAGATCGTCTTATAAAAATA
TTTTTTATATAAATATTGGTTCAAAATTTGCAAGACTCGGCTTCTTACCA
ACAGATGTACCATGTCGAATTATAGGGTTACATATAAAAATCGATGCATT
AGCTGTGGCGTCGAAGTACCAGTCCTTTCCACAAATGGATGCCATTTCAA
AGTTCAGGACAAATTTAATTCTTGTGGCTCCAAAATAAGCAATCCTCGAA
AACGGCCGAGTCAAATAAAAAGGCACAGGAATATTTCTCAAAGAAAGCTA
AATAATGGTTTTAAATGGTCTTCATCATCTACGAAAAAACGATTCTATCC
GTTAGTAAAGAAACAAAAATTGTTGATGTCCTCAGAGCCCTCTCATAAGG
CTCTAATTTTAAGAGAGATGATTAGGTTAGGAAGAAAACCGAATCGAAAG
TTCGAAAAGGCTGCGAGAAATAGTGTATTTCCGGGCATCTGCCGTACGAT
ATTGAAACTGCACCAGTATACTAATCTTGTACAGTAGAGATTACTGATGT
CACAGATTCTTTTGAGATCAAAGTCCCCACCATATGGAATCATTTGGATG
GATGGATCAATGGATGTAGATGAAATGGGTACATGCAGACATATATTTTT
AGAAGAATCAATGGAAATTTAAGTATTTAAATATTTATTAAGCTAACGTA
CTTATATTGTGTACAACAGTTTTCAATTAAATGGAATAGGAAAATAAAGT
CCTGGATGAGGTACATTTACATTGTAAAAAAAAAAAAAAAAAAAAA

MIP06162.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:26
Subject Length Description Subject Range Query Range Score Percent Strand
DMG6-MB6.chr2L.17.031.a 799 DMG6-MB6.chr2L.17.031.a 25..799 1..775 3875 100 Plus
FucTB-RA 1663 FucTB-RA 1608..1663 778..723 280 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:31:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9426848..9427332 1..485 2395 99.6 Plus
chr2L 23010047 chr2L 9427385..9427676 484..775 1445 99.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG42847-RA 426 CG42847-PA 1..426 112..537 2130 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:21 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:31:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG42847-RA 817 CG42847-RA 43..817 1..775 3875 100 Plus
FucTB-RD 1618 CG4435-RD 1547..1618 775..704 360 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42847-PA 141 CG42847-PA 1..141 112..534 743 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9427912..9428396 1..485 2425 100 Plus
2L 23513712 2L 9428449..9428743 484..778 1475 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9427912..9428396 1..485 2425 100 Plus
2L 23513712 2L 9428449..9428743 484..778 1475 100 Plus
Blast to na_te.dros performed 2014-11-27 13:31:48
Subject Length Description Subject Range Query Range Score Percent Strand
looper1 1881 looper1 LOOPER1_DM 1881bp 1785..1822 676..639 118 78.9 Minus
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 194..280 639..722 112 63.6 Plus

MIP06162.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:36:18 Download gff for MIP06162.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9427386..9427676 485..775 99   Plus
chr2L 9426848..9427331 1..484 93 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:36:43 Download gff for MIP06162.complete
Subject Subject Range Query Range Percent Splice Strand
CG42847-RA 1..426 112..537 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:43:24 Download gff for MIP06162.complete
Subject Subject Range Query Range Percent Splice Strand
CG42847-RA 1..426 112..537 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:36:18 Download gff for MIP06162.complete
Subject Subject Range Query Range Percent Splice Strand
CG42847-RA 1..426 112..537 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:36:43 Download gff for MIP06162.complete
Subject Subject Range Query Range Percent Splice Strand
CG42847-RA 1..775 1..775 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:43:24 Download gff for MIP06162.complete
Subject Subject Range Query Range Percent Splice Strand
CG42847-RA 43..817 1..775 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:36:18 Download gff for MIP06162.complete
Subject Subject Range Query Range Percent Splice Strand
CG42847-RA 43..817 1..775 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:36:18 Download gff for MIP06162.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9428450..9428740 485..775 100   Plus
2L 9427912..9428395 1..484 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:43:24 Download gff for MIP06162.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9428450..9428740 485..775 100   Plus
arm_2L 9427912..9428395 1..484 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:10:21 Download gff for MIP06162.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9428450..9428740 485..775 100   Plus
2L 9427912..9428395 1..484 100 -> Plus

MIP06162.pep Sequence

Translation from 111 to 536

> MIP06162.pep
MSNYRVTYKNRCISCGVEVPVLSTNGCHFKVQDKFNSCGSKISNPRKRPS
QIKRHRNISQRKLNNGFKWSSSSTKKRFYPLVKKQKLLMSSEPSHKALIL
REMIRLGRKPNRKFEKAARNSVFPGICRTILKLHQYTNLVQ*

MIP06162.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 16:43:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG42847-PA 141 CG42847-PA 1..141 1..141 743 100 Plus

MIP06162.hyp Sequence

Translation from 111 to 536

> MIP06162.hyp
MSNYRVTYKNRCISCGVEVPVLSTNGCHFKVQDKFNSCGSKISNPRKRPS
QIKRHRNISQRKLNNGFKWSSSSTKKRFYPLVKKQKLLMSSEPSHKALIL
REMIRLGRKPNRKFEKAARNSVFPGICRTILKLHQYTNLVQ*

MIP06162.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG42847-PA 141 CG42847-PA 1..141 1..141 743 100 Plus