Clone MIP06166 Report

Search the DGRC for MIP06166

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:61
Well:66
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42855-RB
Protein status:MIP06166.pep: gold
Sequenced Size:963

Clone Sequence Records

MIP06166.complete Sequence

963 bp assembled on 2009-02-20

GenBank Submission: BT064657.1

> MIP06166.complete
TTTCAAGTGAACATAATCCAGTTTTCAGATTGTTCTATATTTTCCATAGA
TTTTTTAAGTTTTATTTCTCAAGAAAAATGGTCTCCTTTGGCGGTGTGGC
AAAACTATTGAGCAGCTTCGAGTGCTGTGCCAGTTCGTGGGTCAAAGCCG
TAAATCCCGGATGGTACGAGGCTCGTGAGATTCCGAAGACCATCCTGATC
CAGAAAGTGCGACAGGTGCCCCAGAATACCAGGGTGATACGCCAGAGACC
CCAAACCGCGGAGCCGCCCAAAAAATCCTCCAGCCAAAAGCGCCAACTTT
ATCTCTAAGCTCCAAAAAGTTGGGGAAATAATGACTCATTGATTTAAGTG
TTTTAATCGAATGTACATTGTATTGAGTTGTCTCGCAGTCGTCATCGATT
TCGTCATTTTGTCTGCTTCGCTACACGGCCACACTGAGTCGGTGCCGAGT
TTTTGCTTCGCGAGCAGGTGGTGTTGTCCAATCAGAATCGCGTAGACGGC
ACGAATAACAGAAAAAAATTCCAATAGAACAGCCGAGGGCGATTATTTAT
GTGTGTTCATGTTAAATGTTAAATGCAAAATTACGCGTCGCACGCTGCGC
CCACGCGATTTCGAATCCGCATCCGATTGTTCAGTGCAAACACACACACA
CCAACCAAGTGAATATAATATGTAAGCGAAAGGCAAGAAGCCAGCAACAA
AGCGCCAGTGATAAGCGCAATAATATAAATGCAATATAGTATAAATTCAA
CGTGAAAAGAAATCTCGCCAGCGAAATACAAAAAAAAGCGGAGGAAGCGA
CAAATGGAAATCAAGTAAAATGAAGAAGAGCGGAGAGATAGAAATCGTAA
TGTGTAAGCGCGACCAGAGCGTATGAAAAAATCGAAAAAAAAAAACGGTG
GAGCGAAGATTAAATAAATTTACAAGTGTGTTTTGTATTTGACCAAAAAA
AAAAAAAAAAAAA

MIP06166.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG15072.e 3587 CG15072.e 1..531 416..945 2615 99.8 Plus
CG15072.b 3058 CG15072.b 1..101 746..846 505 100 Plus
CG15072.d 3026 CG15072.d 1..69 746..814 345 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:14:19
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14575188..14575761 375..944 2675 99 Plus
chr2R 21145070 chr2R 14574490..14574830 1..341 1675 99.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:14:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG42855-RB 231 CG42855-PB 1..231 78..308 1155 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:23 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:14:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG42855-RB 945 CG42855-RB 1..945 1..944 4675 99.9 Plus
Sik3-RC 6469 CG18604-RA 1..419 436..853 2045 99.8 Plus
Sik3-RF 6011 CG42856-RF 1..237 436..671 1135 99.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:14:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG42855-PB 76 CG42855-PB 1..76 78..305 394 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:14:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18688071..18688642 375..945 2810 99.8 Plus
2R 25286936 2R 18687372..18687712 1..341 1705 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18689270..18689841 375..945 2820 99.8 Plus
2R 25260384 2R 18688571..18688911 1..341 1705 100 Plus
2R 25260384 2R 18689174..18689208 341..375 175 100 Plus
Blast to na_te.dros performed on 2014-11-27 05:14:15 has no hits.

MIP06166.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:28:39 Download gff for MIP06166.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14575189..14575761 376..944 98   Plus
chr2R 14575093..14575126 342..375 100 -> Plus
chr2R 14574490..14574830 1..341 99 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:36:46 Download gff for MIP06166.complete
Subject Subject Range Query Range Percent Splice Strand
CG42855-RB 1..231 78..308 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:53:13 Download gff for MIP06166.complete
Subject Subject Range Query Range Percent Splice Strand
CG42855-RB 1..231 78..308 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:28:39 Download gff for MIP06166.complete
Subject Subject Range Query Range Percent Splice Strand
CG42855-RB 1..231 78..308 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-20 22:39:42 Download gff for MIP06166.complete
Subject Subject Range Query Range Percent Splice Strand
CG15072-RB 1..42 829..870 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:36:46 Download gff for MIP06166.complete
Subject Subject Range Query Range Percent Splice Strand
CG42855-RB 1..945 1..944 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:53:13 Download gff for MIP06166.complete
Subject Subject Range Query Range Percent Splice Strand
CG42855-RB 1..945 1..944 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:28:39 Download gff for MIP06166.complete
Subject Subject Range Query Range Percent Splice Strand
CG42855-RB 1..945 1..944 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:28:39 Download gff for MIP06166.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18688072..18688641 376..944 99   Plus
2R 18687976..18688009 342..375 100 -> Plus
2R 18687372..18687712 1..341 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:53:13 Download gff for MIP06166.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14575577..14576146 376..944 99   Plus
arm_2R 14575481..14575514 342..375 100 -> Plus
arm_2R 14574877..14575217 1..341 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:10:25 Download gff for MIP06166.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18689271..18689840 376..944 99   Plus
2R 18689175..18689208 342..375 100 -> Plus
2R 18688571..18688911 1..341 100 -> Plus

MIP06166.pep Sequence

Translation from 2 to 307

> MIP06166.pep
SSEHNPVFRLFYIFHRFFKFYFSRKMVSFGGVAKLLSSFECCASSWVKAV
NPGWYEAREIPKTILIQKVRQVPQNTRVIRQRPQTAEPPKKSSSQKRQLY
L*

MIP06166.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 16:41:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21915-PA 62 GG21915-PA 1..52 26..77 268 96.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 16:41:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG42855-PB 76 CG42855-PB 1..76 26..101 394 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 16:41:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21907-PA 76 GM21907-PA 1..76 26..101 363 92.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 16:41:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11402-PA 76 GD11402-PA 1..76 26..101 357 90.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 16:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11991-PA 76 GE11991-PA 1..76 26..101 360 89.5 Plus

MIP06166.hyp Sequence

Translation from 2 to 307

> MIP06166.hyp
SSEHNPVFRLFYIFHRFFKFYFSRKMVSFGGVAKLLSSFECCASSWVKAV
NPGWYEAREIPKTILIQKVRQVPQNTRVIRQRPQTAEPPKKSSSQKRQLY
L*

MIP06166.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:03:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG42855-PB 76 CG42855-PB 1..76 26..101 394 100 Plus