Clone MIP06235 Report

Search the DGRC for MIP06235

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:62
Well:35
Vector:pOT2|pOTB7_DraIII
Associated Gene/Transcript4EHP-RC
Protein status:MIP06235.pep: gold
Sequenced Size:1653

Clone Sequence Records

MIP06235.complete Sequence

1653 bp assembled on 2009-04-03

GenBank Submission: BT081409.1

> MIP06235.complete
AAGAAACGTCAAACTAAAGTCGAGCGAACCAAAACTAAACGGCCAAAAAA
TAAGCAAACCCACTGATAACCGGAAAGGATAAGGCACAGGAAATACGATT
GTTTACCAGAGAGAGCGGCGGACCCGTAGCGAACCGCTCCCCGAAAAAGC
GGCTGCCCCAAAAAATCGCCCATAAGAGAATCCACCAAAAACCCATTTGC
CCACACACACACACACACACAACACACACACACGCAGCCAAGGAGCAAAA
GAAGAATTGCGCCAGAAGAAGCAGCAGCATAAAGAATCTAGTAGTGCAAA
CACCCGGATCCACAGGTACTCGTTCCAGAGGTTGGAACAGCGCCACAGGA
ACAGCCAAGCAGTCAGCAGGAGAGCACCAGTATCAGCTACCAGTCAGCAT
CATAATTGCCAGGATGAGCATGGAGAAAGTAGCCAACAAGCAGTACGAGA
CGAAAAACTGGCCAGATATTGTCGACAGCGACGACAGCGATGTGGATAAT
CAGATAGATGTGGACAACCTGCCACCACTGGAGGTGGGTCCCGGCGAGAA
CCGGCTGCAGCACACATACTGCCTCTGGTTCTCTCGCAAGGAGACGCAGC
GCGCGGCCGCCGACTACAGCAAGTCGCTGCACATGGTCGGCCGGTGCGCC
AGCGTGCAGCAGTGGTGGTCGCTCTACTCGCACCTCATCCGGCCCACCGC
CCTGAAGCCCTACCGGGAGCTCCTCCTCTTCAAGCAGGGCATCATACCGA
TGTGGGAGGACCCGGCGAACAGCAAGGGCGGCCAGTGGTTGATACGACTA
CGCAAGAACAAGGTCGACCGGGCCTGGGAGAACGTTTGTATGGCGATGCT
CGGGGAGCAGTTCCTCGTCGGCGACGAGATATGCGGAGTCGTGCTACAGA
CGAAATATCCGATAAAAACCGAACACAGCCGGCCAATGCATACAAATGAG
CGAAGGAGCGATGGAGTCACGTAGCCACCAGGACGCACCTCATCCCTCGT
GGAGCGGCTTCAGAGCGGTGGCTCTAATTAAGACAGGCCTGGTCTGGTCT
GGGCCAAAATTAATGGATGCCACGAGCGGCGGAGGAGCATTTTCGGTGTT
CACACAAATTAAATTCCATCAAGTTTATTTGCTGTAAATGAGGCAGTGGC
ACAAAAGGAGTGCAAGTGCTGGGCCTAATTTAATTTGCCCGACCCTTAAC
CCTTTGTGTGCCCCCGACACGTTTTGCCATGTAACAACCATTTGCCACTT
AGAAGCGAAACAATAGGCCTATAGACAACTACACTTGGACACCCAGAGAT
GCTAAATCAGATCGTTCGGTTTATATTCGTTAAATTTTCCATGTAAATAG
TCATTATAATTATTATTGTGGTCTACGCTGAATTGTGACGTGAGCAAATT
CAGCGGTTATCCCAGGAAAACCGAAAGTTGTAAACATAAATCTAATATTT
ATTACGAAACTTCATATGTGTGCTTCTTGCAAATGCTATGATTGCAAAAT
TAAAAACGAAATACAAAGCAAAGAGACGAAAGAGCAGAGGGCAAATCTAT
TAATTAGTAATTATTATAATGTGATGTTATATATATAAATCAATCTTTAA
CAAGAAACCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

MIP06235.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
4EHP-RB 1416 4EHP-RB 46..957 1..912 4545 99.8 Plus
4EHP.d 1692 4EHP.d 30..941 1..912 4545 99.8 Plus
4EHP-RA 1457 4EHP-RA 152..1062 1..911 4540 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 19890760..19891455 1610..911 3310 98.9 Minus
chr3R 27901430 chr3R 19930145..19930604 911..452 2255 99.3 Minus
chr3R 27901430 chr3R 19931789..19932238 452..1 2150 98.9 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:57:38
Subject Length Description Subject Range Query Range Score Percent Strand
4EHP-RC 561 CG33100-PC 1..561 414..974 2805 100 Plus
4EHP-RB 747 CG33100-PB 1..499 414..912 2495 100 Plus
4EHP-RD 729 CG33100-PD 1..498 414..911 2490 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:31 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:57:37
Subject Length Description Subject Range Query Range Score Percent Strand
4EHP-RC 4539 CG33100-RC 41..1650 1..1610 8035 99.9 Plus
4EHP-RB 2401 CG33100-RB 41..952 1..912 4545 99.9 Plus
4EHP-RD 1324 CG33100-RD 41..951 1..911 4540 99.9 Plus
4EHP-RB 2401 CG33100-RB 1702..2401 911..1610 3500 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:57:40
Subject Length Description Subject Range Query Range Score Percent Strand
4EHP-PC 186 CG33100-PC 1..186 414..971 901 100 Plus
4EHP-PA 223 CG33100-PA 1..166 414..911 794 100 Plus
4EHP-PD 242 CG33100-PD 1..166 414..911 794 100 Plus
4EHP-PB 248 CG33100-PB 1..166 414..911 794 100 Plus
eIF4E-5-PA 232 CG8277-PA 57..173 555..905 216 35.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:57:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 24067336..24068065 1640..911 3530 98.9 Minus
3R 32079331 3R 24106825..24107284 911..452 2300 100 Minus
3R 32079331 3R 24108469..24108920 452..1 2245 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:32
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 23808167..23808896 1640..911 3530 98.9 Minus
3R 31820162 3R 23847656..23848115 911..452 2300 100 Minus
3R 31820162 3R 23849300..23849751 452..1 2245 99.7 Minus
Blast to na_te.dros performed on 2014-11-26 19:57:36 has no hits.

MIP06235.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:02:49 Download gff for MIP06235.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 19931790..19932238 1..451 91   Minus
chr3R 19930145..19930604 452..911 99 <- Minus
chr3R 19890760..19891454 912..1610 98 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:28:55 Download gff for MIP06235.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RB 1..499 414..912 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:43:12 Download gff for MIP06235.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RC 1..561 414..974 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:33:43 Download gff for MIP06235.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RC 1..561 414..974 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:02:49 Download gff for MIP06235.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RC 1..561 414..974 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:28:55 Download gff for MIP06235.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RB 30..941 1..912 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:43:12 Download gff for MIP06235.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RC 1..1610 1..1610 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:33:43 Download gff for MIP06235.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RC 41..1650 1..1610 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:02:49 Download gff for MIP06235.complete
Subject Subject Range Query Range Percent Splice Strand
4EHP-RC 41..1650 1..1610 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:02:49 Download gff for MIP06235.complete
Subject Subject Range Query Range Percent Splice Strand
3R 24108470..24108920 1..451 99   Minus
3R 24106825..24107284 452..911 100 <- Minus
3R 24067366..24068064 912..1610 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:33:43 Download gff for MIP06235.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 19934192..19934642 1..451 99   Minus
arm_3R 19932547..19933006 452..911 100 <- Minus
arm_3R 19893088..19893786 912..1610 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:18:09 Download gff for MIP06235.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23849301..23849751 1..451 99   Minus
3R 23847656..23848115 452..911 100 <- Minus
3R 23808197..23808895 912..1610 100 <- Minus

MIP06235.pep Sequence

Translation from 413 to 973

> MIP06235.pep
MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSDGVT*

MIP06235.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 16:10:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23230-PA 172 GF23230-PA 1..167 1..167 837 90.4 Plus
Dana\GF23736-PA 261 GF23736-PA 53..201 12..164 220 33.3 Plus
Dana\GF10894-PA 230 GF10894-PA 55..171 48..164 207 35 Plus
Dana\GF10327-PA 271 GF10327-PA 80..212 34..164 206 34.6 Plus
Dana\GF25106-PA 244 GF25106-PA 37..185 32..164 205 30.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 16:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12377-PA 223 GG12377-PA 1..166 1..166 796 92.2 Plus
Dere\GG14453-PA 231 GG14453-PA 56..172 48..164 215 37.5 Plus
Dere\GG14292-PA 244 GG14292-PA 69..185 48..164 210 35 Plus
Dere\GG14044-PA 250 GG14044-PA 74..190 48..164 204 33.3 Plus
Dere\GG12718-PA 448 GG12718-PA 262..388 38..164 204 35.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 16:10:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19097-PA 223 GH19097-PA 1..166 1..166 764 88 Plus
Dgri\GH16860-PA 275 GH16860-PA 99..215 48..164 223 36.7 Plus
Dgri\GH12729-PA 300 GH12729-PA 100..240 19..164 223 33.6 Plus
Dgri\GH14978-PA 232 GH14978-PA 57..173 48..164 220 35.8 Plus
Dgri\GH24331-PA 222 GH24331-PA 34..162 32..164 210 34.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 16:10:48
Subject Length Description Subject Range Query Range Score Percent Strand
4EHP-PC 186 CG33100-PC 1..186 1..186 1012 100 Plus
4EHP-PA 223 CG33100-PA 1..166 1..166 905 100 Plus
4EHP-PD 242 CG33100-PD 1..166 1..166 905 100 Plus
4EHP-PB 248 CG33100-PB 1..166 1..166 905 100 Plus
eIF4E-5-PA 232 CG8277-PA 57..173 48..164 216 35.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 16:10:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23433-PA 171 GI23433-PA 1..165 3..167 761 89.1 Plus
Dmoj\GI13141-PA 238 GI13141-PA 63..179 48..164 211 35 Plus
Dmoj\GI12684-PA 246 GI12684-PA 66..187 43..164 211 34.4 Plus
Dmoj\GI14982-PA 311 GI14982-PA 135..251 48..164 206 36.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 16:10:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24147-PA 231 GL24147-PA 1..174 1..177 774 85.3 Plus
Dper\GL12850-PA 198 GL12850-PA 22..138 48..164 214 35 Plus
Dper\GL13241-PA 223 GL13241-PA 22..164 30..164 205 30.8 Plus
Dper\GL14400-PA 233 GL14400-PA 43..173 34..164 200 29.9 Plus
Dper\GL26506-PA 219 GL26506-PA 44..160 48..164 188 31.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 16:10:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26519-PB 216 GA26519-PB 1..166 1..166 772 89.8 Plus
Dpse\GA28658-PA 263 GA28658-PA 87..203 48..164 215 35 Plus
Dpse\GA28599-PA 223 GA28599-PA 48..164 48..164 205 34.2 Plus
Dpse\GA28380-PA 227 GA28380-PA 40..168 38..164 205 36.4 Plus
Dpse\GA23005-PA 233 GA23005-PA 43..173 34..164 202 30.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 16:10:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23515-PA 223 GM23515-PA 1..166 1..166 902 99.4 Plus
Dsec\GM25004-PA 233 GM25004-PA 58..174 48..164 212 35.8 Plus
Dsec\GM13832-PA 229 GM13832-PA 54..170 48..164 210 34.2 Plus
Dsec\GM24878-PA 269 GM24878-PA 93..209 48..164 205 33.3 Plus
Dsec\GM25034-PA 244 GM25034-PA 69..185 48..164 200 34.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 16:11:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18325-PA 223 GD18325-PA 1..166 1..166 901 98.8 Plus
Dsim\GD14038-PA 233 GD14038-PA 58..174 48..164 214 35.8 Plus
Dsim\GD13118-PA 229 GD13118-PA 54..170 48..164 210 34.2 Plus
Dsim\GD12928-PA 269 GD12928-PA 93..209 48..164 205 33.3 Plus
Dsim\GD14067-PA 244 GD14067-PA 69..185 48..164 200 34.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 16:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14537-PA 221 GJ14537-PA 1..164 3..166 764 90.2 Plus
Dvir\GJ13832-PA 272 GJ13832-PA 96..212 48..164 224 36.7 Plus
Dvir\GJ13889-PA 238 GJ13889-PA 63..179 48..164 216 35.8 Plus
Dvir\GJ12668-PA 230 GJ12668-PA 50..171 43..164 210 34.4 Plus
Dvir\GJ12520-PA 240 GJ12520-PA 65..181 48..164 205 34.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 16:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11937-PA 221 GK11937-PA 1..164 3..166 756 89 Plus
Dwil\GK14373-PA 235 GK14373-PA 52..176 40..164 237 36.7 Plus
Dwil\GK12168-PA 260 GK12168-PA 84..200 48..164 236 37.5 Plus
Dwil\GK20927-PA 266 GK20927-PA 90..206 48..164 224 36.7 Plus
Dwil\GK17737-PA 217 GK17737-PA 42..158 48..164 212 36.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 16:11:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10831-PA 223 GE10831-PA 1..166 1..166 792 91.6 Plus
Dyak\GE21642-PA 231 GE21642-PA 56..172 48..164 214 36.7 Plus
Dyak\GE20721-PA 244 GE20721-PA 69..185 48..164 208 34.2 Plus
Dyak\GE21247-PA 269 GE21247-PA 93..209 48..164 203 33.3 Plus
Dyak\GE20475-PA 229 GE20475-PA 54..170 48..164 197 33.3 Plus

MIP06235.hyp Sequence

Translation from 413 to 973

> MIP06235.hyp
MSMEKVANKQYETKNWPDIVDSDDSDVDNQIDVDNLPPLEVGPGENRLQH
TYCLWFSRKETQRAAADYSKSLHMVGRCASVQQWWSLYSHLIRPTALKPY
RELLLFKQGIIPMWEDPANSKGGQWLIRLRKNKVDRAWENVCMAMLGEQF
LVGDEICGVVLQTKYPIKTEHSRPMHTNERRSDGVT*

MIP06235.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:00
Subject Length Description Subject Range Query Range Score Percent Strand
4EHP-PC 186 CG33100-PC 1..186 1..186 1012 100 Plus
4EHP-PA 223 CG33100-PA 1..166 1..166 905 100 Plus
4EHP-PD 242 CG33100-PD 1..166 1..166 905 100 Plus
4EHP-PB 248 CG33100-PB 1..166 1..166 905 100 Plus
eIF4E-5-PA 232 CG8277-PA 57..173 48..164 216 35.8 Plus