Clone MIP06256 Report

Search the DGRC for MIP06256

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:62
Well:56
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42660-RA
Protein status:MIP06256.pep: gold
Sequenced Size:2546

Clone Sequence Records

MIP06256.complete Sequence

2546 bp assembled on 2009-04-29

GenBank Submission: BT082101.1

> MIP06256.complete
CAAAAATCTAAATGTTAAATTTTTTATTTTCATCTGAGCTATAATGTGCA
TTTGCTCAACTCGTGTACTCAAAATCGTTCTTTTGGCATTCATACATCTT
GCCGCAGGATTTAATGGCGCGCAAATAGCGAAGGACATTACTTTGCTGGA
TAAACTGGTGGGTCACCATCATGTTATGCTTACTATAAGTCTAGCACTAT
GTGTTATCATACTAGTTGTTCTCTTAGTTGCCATTTTTGCTGCTATTCGT
CATCATATATTGGCTTTAAACGTGACGCTTGTTTTCTTGATTTTTAAGTG
TGTAGCAAAGGGTATTATCGTAATCGTTTGCGTATTAACCGCAGAAACAG
GTATTGAAAATACTGCCGCACATTTTTGGTTCTTTCTATGCTGGAAATTC
ACGTGTTGCTGTATGCTCTTTAATCTATTCTTTTATATACGGCTAACAGA
GAATTCAAGACAAGCTGACTAATTCTTATAAAGAGTATTGATTGTGTTCT
TCGAACGAAATATTTTCAAATTCTATCTTGACAGAATGTGCTTTTGTCCG
ACACTTGGTCTCAAAATTGTACTTTTGTTAGTAATACCTATAACCGCAGG
AATTAATGGTGCTCAAATAGCCAAAGATGTTTCTATATTGAATTTATTAA
AGGGATACCATTATATTATGCTTATTATAAGCCTATCCCTGTCCGTAGTT
ATACTGGCGACTCTGGTTCTTTTAATATATGCGGCGATCTGTAATAAAAT
TCGAATTCTGAAAGTGATGATCTTTGTTTATGTAGCCATCGTCGTGGTGA
AACTGATAATTCTGTTCGTGTGTCTAAGTACTGAATTGAATCCTGACAAG
ACGACAGCCCATCCCATATTTATGATATGCTGGCTCCTTACGTTCTTATG
TATGGCCGTTATAATAATATACTGGCTTCGGCTACATGACCTTGCCAACG
AAGACAATTAGACTGGTATTGAAATGAATACTATGAATACTATGAATACT
ATCTGGCATAAACGCAAAATATCGTATTACCTCCTCATTAGATCCGTCAT
TGTGATTTTCAGTGATTAATGTTAAGATATTAACTATGTCGAATAACCAA
CTGCATTAGAGCAAAAACGGAAACTCACTGGAAACTTCATTAATGAATTC
AATTGGAGTTAATACCAAAAGCTAGCTGAATTTGCAAATTATAATGGACA
TCGTATTGTTATACCATCGAAAGCAGTGTCATTTTAGGTCAAAAATATAT
ATATTCGTATTTTTCGGATAAAATATGGTGGATAATGAGGAAACGGGATG
CCTTCAAAGATTACTCAGCGTTGGAAAGCTACAGATTTGCAAGTTCATAA
TCTACTTTGTGTGGTTGGTCAATTTCATTTTCAGCTGTGCGGATATTTAC
ATATACTATTTCATACTGAAGGAACACATGCCTTGCTGGGATTGTTTGTT
CAGGTCCTACATGATAATCGCTCTAACCGTAAATGCCCTAATGGCGCCGC
TGCTGATAGTCGGTTTTTTCTTCATATATTCGCATTTATGCCGCGAAATA
CGCATTTATGCCACAGTACTCTTCCTGGCAACATGGTTGCAGATGATGCT
GACTATACTGTTTGCACAACAGTACCAAATTGTTGGAGATGTACTTCGAA
TATGGATGAATCGCAAGAGTTTGGAATTCTACGAAAGTCGCTGCCAGTGC
TGCGGAGTTTTGGGACCTGACGACTACAAGTTGGGCGATCTGAATATCCC
AAAATCCTGTTACAAGAATGGCAGTGAAAGGGATGAGGACCTGTACCGAT
CAGGCTGCTCCACGCGCTCCATAAAGCCCGCGTCGCCCATCATCCATGTG
ATCTCCTTCGTAATTCAGTATGTTTTAGTCATATGCATTGAGGTATTCCT
TATTATCCTGTTAAGGAGCAAATCCCAACCCACAAGTATGTGGTCTGAGC
GGGTCACCGAAAGGTTTGGTAGTGTAAAAAAGTGACTTGCAGTTCTATTC
GGATTTGGGAAGCAATCCTAAAGAACATCTCTGAACTTTAGGGCTATTTT
CCAACATTGCATGGAACTTAAGCAGCAGATTTTCATGTGAATTGCAATTT
TGGGTGCGGTTTTCAATTCACATTGTACCGGGCATGAGTATTGGCATTCT
GGCGGGCGAGACAAATTGGATGCTGCCGGCTATCGTCATATTTCACGGAC
TGCAATCAATAACGATAAACACTTGAGTCGCAAATCCAATGTCCAGAATC
CTGTCCAACAACGGCATGCATATGGATGAGCCAATAAAGAAATCAACAAA
GCATGTCGGGCGATTGAAAAAGTATTGCAAATACCCCGGATAGCTGGGGA
TTCGGACACGGAATTGGACTCCAATCCGGACAATATGCAAATGCAGCTAA
GCAGAAAATATTCAAGGACGATCCAGCCCCACCCCCTTCAACAAACGCTC
AAGTTTATATATTCATTTTGTGTCCCTCGTCCCGCGCATAAATTTTATTG
TTGTCAACATTAAATTCTAGTCGTGAAAAACAAAAAAAAAAAAAAA

MIP06256.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp66A-RC 1353 Tsp66A-RC 28..1353 1208..2533 6630 100 Plus
Tsp66A-RA 1151 Tsp66A-RA 494..1150 1877..2533 3285 100 Plus
Tsp66A.a 1028 Tsp66A.a 380..1028 1877..2525 3245 100 Plus
Tsp66A-RA 1151 Tsp66A-RA 184..496 1557..1869 1565 100 Plus
Tsp66A.a 1028 Tsp66A.a 70..382 1557..1869 1565 100 Plus
Tsp66A-RA 1151 Tsp66A-RA 1..117 1440..1556 585 100 Plus
Tsp66A.a 1028 Tsp66A.a 1..65 1312..1376 325 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:12:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7460271..7460935 1867..2531 3265 99.4 Plus
chr3L 24539361 chr3L 7458946..7459203 892..1149 1290 100 Plus
chr3L 24539361 chr3L 7459605..7459784 1377..1556 900 100 Plus
chr3L 24539361 chr3L 7460047..7460223 1692..1868 885 100 Plus
chr3L 24539361 chr3L 7457798..7457965 107..274 840 100 Plus
chr3L 24539361 chr3L 7458529..7458696 599..766 840 100 Plus
chr3L 24539361 chr3L 7459379..7459547 1208..1376 830 99.4 Plus
chr3L 24539361 chr3L 7459851..7459985 1557..1691 675 100 Plus
chr3L 24539361 chr3L 7458028..7458157 274..403 650 100 Plus
chr3L 24539361 chr3L 7458753..7458879 766..892 635 100 Plus
chr3L 24539361 chr3L 7457637..7457743 1..107 535 100 Plus
chr3L 24539361 chr3L 7458374..7458477 496..599 520 100 Plus
chr3L 24539361 chr3L 7458214..7458307 403..496 470 100 Plus
chr3L 24539361 chr3L 7459257..7459319 1150..1212 300 98.4 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp66A-RC 711 CG16991-PC 1..711 1275..1985 3555 100 Plus
Tsp66A-RD 711 CG16991-PD 1..711 1275..1985 3555 100 Plus
Tsp66A-RE 717 CG16991-PE 1..717 1275..1985 3460 99.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:35 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG42661-RA 2531 CG42661-RA 1..2531 1..2531 12655 100 Plus
CG42660-RA 2531 CG42660-RA 1..2531 1..2531 12655 100 Plus
Tsp66A-RD 2531 CG16991-RD 1..2531 1..2531 12655 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp66A-PC 236 CG16991-PC 1..236 1275..1982 1251 100 Plus
Tsp66A-PD 236 CG16991-PD 1..236 1275..1982 1251 100 Plus
Tsp66A-PE 238 CG16991-PE 1..238 1275..1982 1238 99.2 Plus
Tsp66A-PF 234 CG16991-PF 1..234 1275..1982 1224 99.2 Plus
CG42660-PB 142 CG42660-PB 1..142 44..469 633 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:11:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7468144..7468810 1867..2533 3335 100 Plus
3L 28110227 3L 7466818..7467075 892..1149 1290 100 Plus
3L 28110227 3L 7467478..7467657 1377..1556 900 100 Plus
3L 28110227 3L 7467920..7468096 1692..1868 885 100 Plus
3L 28110227 3L 7467252..7467420 1208..1376 845 100 Plus
3L 28110227 3L 7465670..7465837 107..274 840 100 Plus
3L 28110227 3L 7466401..7466568 599..766 840 100 Plus
3L 28110227 3L 7467724..7467858 1557..1691 675 100 Plus
3L 28110227 3L 7465900..7466029 274..403 650 100 Plus
3L 28110227 3L 7466625..7466751 766..892 635 100 Plus
3L 28110227 3L 7465509..7465615 1..107 535 100 Plus
3L 28110227 3L 7466246..7466349 496..599 520 100 Plus
3L 28110227 3L 7466086..7466179 403..496 470 100 Plus
3L 28110227 3L 7467129..7467191 1150..1212 300 98.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:09:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7461244..7461910 1867..2533 3335 100 Plus
3L 28103327 3L 7459918..7460175 892..1149 1290 100 Plus
3L 28103327 3L 7460578..7460757 1377..1556 900 100 Plus
3L 28103327 3L 7461020..7461196 1692..1868 885 100 Plus
3L 28103327 3L 7460352..7460520 1208..1376 845 100 Plus
3L 28103327 3L 7458770..7458937 107..274 840 100 Plus
3L 28103327 3L 7459501..7459668 599..766 840 100 Plus
3L 28103327 3L 7460824..7460958 1557..1691 675 100 Plus
3L 28103327 3L 7459000..7459129 274..403 650 100 Plus
3L 28103327 3L 7459725..7459851 766..892 635 100 Plus
3L 28103327 3L 7458609..7458715 1..107 535 100 Plus
3L 28103327 3L 7459346..7459449 496..599 520 100 Plus
3L 28103327 3L 7459186..7459279 403..496 470 100 Plus
3L 28103327 3L 7460229..7460291 1150..1212 300 98.4 Plus
Blast to na_te.dros performed on 2014-11-27 16:11:57 has no hits.

MIP06256.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:13:48 Download gff for MIP06256.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7460273..7460935 1869..2531 99   Plus
chr3L 7460047..7460223 1692..1868 100 -> Plus
chr3L 7459851..7459985 1557..1691 100 -> Plus
chr3L 7459605..7459784 1377..1556 100 -> Plus
chr3L 7459380..7459547 1209..1376 99 -> Plus
chr3L 7459257..7459315 1150..1208 100 -> Plus
chr3L 7458947..7459203 893..1149 88 -> Plus
chr3L 7458754..7458879 767..892 100 -> Plus
chr3L 7458529..7458696 599..766 100 -> Plus
chr3L 7458375..7458476 497..598 100 -> Plus
chr3L 7458215..7458307 404..496 100 -> Plus
chr3L 7458029..7458157 275..403 100 -> Plus
chr3L 7457798..7457965 107..274 100 -> Plus
chr3L 7457637..7457742 1..106 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:51:18 Download gff for MIP06256.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RC 1..711 1275..1985 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:46:51 Download gff for MIP06256.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RC 1..711 1275..1985 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:31:17 Download gff for MIP06256.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RD 1..711 1275..1985 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:13:48 Download gff for MIP06256.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RD 1..711 1275..1985 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-29 08:59:03 Download gff for MIP06256.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RC 1..1267 1259..2525 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:46:51 Download gff for MIP06256.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RD 1..2531 1..2531 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:31:17 Download gff for MIP06256.complete
Subject Subject Range Query Range Percent Splice Strand
CG42660-RA 1..2531 1..2531 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:13:48 Download gff for MIP06256.complete
Subject Subject Range Query Range Percent Splice Strand
Tsp66A-RD 1..2531 1..2531 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:13:48 Download gff for MIP06256.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7468146..7468808 1869..2531 100   Plus
3L 7467920..7468096 1692..1868 100 -> Plus
3L 7467724..7467858 1557..1691 100 -> Plus
3L 7467478..7467657 1377..1556 100 -> Plus
3L 7467253..7467420 1209..1376 100 -> Plus
3L 7467129..7467187 1150..1208 100 -> Plus
3L 7466819..7467075 893..1149 100 -> Plus
3L 7466626..7466751 767..892 100 -> Plus
3L 7466401..7466568 599..766 100 -> Plus
3L 7466247..7466348 497..598 100 -> Plus
3L 7466087..7466179 404..496 100 -> Plus
3L 7465901..7466029 275..403 100 -> Plus
3L 7465670..7465837 107..274 100 -> Plus
3L 7465509..7465614 1..106 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:31:17 Download gff for MIP06256.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7461246..7461908 1869..2531 100   Plus
arm_3L 7461020..7461196 1692..1868 100 -> Plus
arm_3L 7460824..7460958 1557..1691 100 -> Plus
arm_3L 7460578..7460757 1377..1556 100 -> Plus
arm_3L 7460353..7460520 1209..1376 100 -> Plus
arm_3L 7460229..7460287 1150..1208 100 -> Plus
arm_3L 7459919..7460175 893..1149 100 -> Plus
arm_3L 7459726..7459851 767..892 100 -> Plus
arm_3L 7459501..7459668 599..766 100 -> Plus
arm_3L 7459347..7459448 497..598 100 -> Plus
arm_3L 7459187..7459279 404..496 100 -> Plus
arm_3L 7459001..7459129 275..403 100 -> Plus
arm_3L 7458770..7458937 107..274 100 -> Plus
arm_3L 7458609..7458714 1..106 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:32:37 Download gff for MIP06256.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7461246..7461908 1869..2531 100   Plus
3L 7461020..7461196 1692..1868 100 -> Plus
3L 7460824..7460958 1557..1691 100 -> Plus
3L 7460578..7460757 1377..1556 100 -> Plus
3L 7460353..7460520 1209..1376 100 -> Plus
3L 7460229..7460287 1150..1208 100 -> Plus
3L 7459919..7460175 893..1149 100 -> Plus
3L 7459726..7459851 767..892 100 -> Plus
3L 7459501..7459668 599..766 100 -> Plus
3L 7459347..7459448 497..598 100 -> Plus
3L 7459187..7459279 404..496 100 -> Plus
3L 7459001..7459129 275..403 100 -> Plus
3L 7458770..7458937 107..274 100 -> Plus
3L 7458609..7458714 1..106 100 -> Plus

MIP06256.pep Sequence

Translation from 43 to 471

> MIP06256.pep
MCICSTRVLKIVLLAFIHLAAGFNGAQIAKDITLLDKLVGHHHVMLTISL
ALCVIILVVLLVAIFAAIRHHILALNVTLVFLIFKCVAKGIIVIVCVLTA
ETGIENTAAHFWFFLCWKFTCCCMLFNLFFYIRLTENSRQAD*

MIP06256.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG42660-PB 142 CG42660-PB 1..142 1..142 735 100 Plus
CG42660-PA 142 CG42660-PA 1..142 1..142 735 100 Plus
CG42661-PB 141 CG42661-PB 1..133 1..134 283 45.5 Plus
CG42661-PA 141 CG42661-PA 1..133 1..134 283 45.5 Plus

MIP06256.hyp Sequence

Translation from 1274 to 1984

> MIP06256.hyp
MVDNEETGCLQRLLSVGKLQICKFIIYFVWLVNFIFSCADIYIYYFILKE
HMPCWDCLFRSYMIIALTVNALMAPLLIVGFFFIYSHLCREIRIYATVLF
LATWLQMMLTILFAQQYQIVGDVLRIWMNRKSLEFYESRCQCCGVLGPDD
YKLGDLNIPKSCYKNGSERDEDLYRSGCSTRSIKPASPIIHVISFVIQYV
LVICIEVFLIILLRSKSQPTSMWSERVTERFGSVKK*

MIP06256.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:09:55
Subject Length Description Subject Range Query Range Score Percent Strand
Tsp66A-PC 236 CG16991-PC 1..236 1..236 1251 100 Plus
Tsp66A-PD 236 CG16991-PD 1..236 1..236 1251 100 Plus
Tsp66A-PE 238 CG16991-PE 1..238 1..236 1238 99.2 Plus
Tsp66A-PF 234 CG16991-PF 1..234 1..236 1224 99.2 Plus