Clone MIP06293 Report

Search the DGRC for MIP06293

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:62
Well:93
Vector:pOT2|pOTB7_DraIII
Associated Gene/Transcriptdlg1-RO
Protein status:MIP06293.pep: gold
Sequenced Size:2359

Clone Sequence Records

MIP06293.complete Sequence

2359 bp assembled on 2009-04-04

GenBank Submission: BT081965.1

> MIP06293.complete
CGGGTGTGCGGAATTTTGGTCTTTCGACCTGGCCAATGTAACAAGTTATC
AAGCCAAAGGCACTGCGAAATTCAACTCTCAGCATTCACTATGGTGAATG
CAATATAGAATCAAATCAAGTGAACGCGAAGTAAGCAAATAAACGATCTG
AGTTTTTTTTTGTGTTGGTGTTGTTGTGTTGTGACGAGGAAAGTACGACA
TTTCGATGATAGTCGCATTGCAATATAAAGTGCAACATAAATGCTATAGA
ACCGAATGTGAATGTGAGGAGCCATTGAGCTGTGAAATGTGAAAATCGCA
AAGAAATCGAGAGAAAACGCACACGTCAATGTAACCACAAAGCTGCCCCA
AGAAAACGAAAAATATATATACAGATGTGCTGGCGAAACTAAAAGGAGGA
GAACTCAAGGAAAAGCCAAAGCGATTTTTCCGCACATTTCCACTCGAAAG
CGACTCCAGTAAATTCTCAAAATTGCGACCCACGCTTTTCCCAGTTCGGC
GGCGTTGAACCACAATCAAAGCTGCTGCACCACCGCCATTTCCGCTGCCA
TTTCCACCAGCACCACCATAAATAGTAGCAGAAACACCGCTCACAGAATG
CCAGTGAAAAAGCAAGAAGCTCATCGGGCTCTCGAGCTGCTCGAGGACTA
CCACGCGAGACTTTCGGAGCCGCAGGATCGGGCGCTGCGTATTGCAATCG
AACGCGTTATACGCATATTTAAATCTCGCTTGTTTCAAGCGCTGTTAGAT
ATACAAGAATTCTATGAATTGACATTATTGGATGACTCGAAGAGCATACA
ACAAAAGACAGCGGAGACCTTGCAAATTGCAACCAAATGGGAAAAGGATG
GCCAGGCAGTCAAAATAGCTGATAATCAGCGCATGCGCATCGAATCGGAC
ACGGAAAATGCCAAGGAGCCAACTGTCGAGCAGCAGCAAAAGCAGCAGCA
AGCGCAGCAGCGCAGTTCCCGCTCCCCGCAGCAGCAGAATCCGCAGCAGC
AGCAGGGATCCAAATCGAGGAGCGGGTCCCAGACTATACAGATACAGTCA
CTTACACAGACATACCCAAACGCACACCAGCGCAAGCGAGTCCTCGTGAG
CCTCCATCCACATCAACATCAACATCAAAGCCAAATTCAACACCAACACC
ATTACCAACTTCGCCATAACAACGGCATTCAAGCCAAAATGCTTAAGCGC
GCTTTTGAGTCCACCTAGTTTTACCCCGCCATTTTCCCGGCGTGGAAAAG
TCCTCGAGGGCAGAGCAATCAGCTCGCGGAAAAGCCAAGGAGGTGGAAAA
CAGCTGGCTGTGTAATTAGCCCCCCCCCCCCTCTGCTCAAAGAATTCATT
AGTTCGCAATTTCGAGGCTGCTCCCATTTGCACTTCATTTCGGGTCTTCA
CAAAAGAATCAAACAAATTAATTAATTTTTCGGAGGCTTTGATTAAATTG
CTCAACATTTAACTCATTTAACGCATAAGGTTGAAAATATCGTTGTTGCT
ACATTTTGTGATTAATTAAAAAACGATGCAACCATAGTTTATCGCTAAGT
TAAGCTAAATTCAAACCGTCTTATTCATATTGTTTAATATATGAGGCGAC
CAAAATGAGGACAAAGATACCCACCTTCCACTAACATTCCGTATGATAAA
TACATTGCTCTAGTTTTTTGCCAGGAATCGAGTCAAAGACCGGATTTAGT
GCCATATTCAGACAACAGATGGAATTTGAATTCGATTTTTTAAGTTGCAT
GTTACACTGCAACCGCATTTTCAGCTTAATTATTCATGTGGCACGGAACG
TGGGCGGTAACGCCCACAATTTTAAATCGCCATTGGTGAGGCCAGTGTAA
TTGGGAGCACGCCAGTGTATTTATCCGCCTTTTTGCCCATTTTCCTGGCT
TTTTAACGAATCGTTACTTACTTAAGACGCTTAAGGCGCTCGGCCTTCTC
GCTTTTGTGGGCCAAGCGTCGCCCATTTCCGTTTCCGGTGCGCTGTTGTT
GTTGCTCGTTGTAGCTAAACTGGCCAGAAGGAGAAAGTACATATAGCAAC
GAGAACGGGAAAACTGCCAACGGGCGTAACACATTTTCTTTATATTAAAG
CTAACGATATTTATACTAAGTTTTTAGTGCACGATTTTGTTTGATTAGTG
CTTACTAGCGAATAAGGTACATTGTGAAAGACATTAAATCAAGCTTATTT
ATAATTTTAGCTTAAGTTTGGTGCATGTTTTGGTTATTAATAATGTTTTA
AGTTGCCAAATTAAATTTGATTTTGATTTAAGAAACATACCATGTGAACC
CCATTTAAAAAATATACATACATTTTGCGCTTCTTATTTGAAAAAAAAAA
AAAAAAAAA

MIP06293.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:03
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-RO 2335 dlg1-RO 1..2335 1..2335 11675 100 Plus
dlg1-RC 2582 dlg1-RC 604..2582 363..2335 9780 99.6 Plus
dlg1.g 2491 dlg1.g 513..2491 363..2335 9780 99.6 Plus
dlg1-RC 2582 dlg1-RC 164..435 91..362 1360 100 Plus
dlg1.g 2491 dlg1.g 73..344 91..362 1360 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:16:42
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11279148..11280451 1036..2340 6445 99.8 Plus
chrX 22417052 chrX 11264976..11265247 91..362 1345 99.6 Plus
chrX 22417052 chrX 11265416..11265669 363..616 1240 99.2 Plus
chrX 22417052 chrX 11278928..11279089 874..1035 810 100 Plus
chrX 22417052 chrX 11267999..11268132 615..748 670 100 Plus
chrX 22417052 chrX 11273016..11273142 747..873 620 99.2 Plus
chrX 22417052 chrX 11264204..11264293 1..90 450 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:16:39
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-RO 621 CG1725-PO 1..621 598..1218 3105 100 Plus
dlg1-RI 627 CG1725-PI 1..627 598..1218 3010 99 Plus
dlg1-RJ 627 CG1725-PJ 1..627 598..1218 3010 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:41 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:16:38
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-RO 2363 CG1725-RO 29..2363 1..2335 11675 100 Plus
dlg1-RI 2114 CG1725-RI 135..2114 362..2335 9775 99.7 Plus
dlg1-RC 2554 CG1725-RC 576..2554 363..2335 9770 99.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:16:41
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-PO 206 CG1725-PO 1..206 598..1215 656 100 Plus
dlg1-PU 198 CG1725-PU 1..198 598..1215 645 81.6 Plus
dlg1-PI 208 CG1725-PI 1..208 598..1215 643 87.5 Plus
dlg1-PJ 208 CG1725-PJ 1..208 598..1215 643 87.5 Plus
dlg1-PC 208 CG1725-PC 1..208 598..1215 643 87.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:16:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11387992..11389297 1036..2341 6530 100 Plus
X 23542271 X 11373817..11374088 91..362 1360 100 Plus
X 23542271 X 11374257..11374510 363..616 1270 100 Plus
X 23542271 X 11387772..11387933 874..1035 810 100 Plus
X 23542271 X 11376840..11376973 615..748 670 100 Plus
X 23542271 X 11381854..11381980 747..873 635 100 Plus
X 23542271 X 11373053..11373142 1..90 450 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:43
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11396090..11397395 1036..2341 6530 100 Plus
X 23527363 X 11381915..11382186 91..362 1360 100 Plus
X 23527363 X 11382355..11382608 363..616 1270 100 Plus
X 23527363 X 11395870..11396031 874..1035 810 100 Plus
X 23527363 X 11384938..11385071 615..748 670 100 Plus
X 23527363 X 11389952..11390078 747..873 635 100 Plus
X 23527363 X 11381151..11381240 1..90 450 100 Plus
Blast to na_te.dros performed 2014-11-27 10:16:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2311..2538 929..1159 237 60 Plus
rover 7318 rover ROVER 7318bp 1930..1997 1120..1187 123 68.1 Plus

MIP06293.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:39:35 Download gff for MIP06293.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11279148..11280451 1036..2340 99   Plus
chrX 11278928..11279089 874..1035 100 -> Plus
chrX 11273018..11273142 749..873 99 -> Plus
chrX 11268001..11268132 617..748 100 -> Plus
chrX 11265416..11265669 363..616 99 -> Plus
chrX 11264976..11265247 91..362 99 -> Plus
chrX 11264204..11264293 1..90 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:57:27 Download gff for MIP06293.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RI 1..627 598..1218 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:43:29 Download gff for MIP06293.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RO 1..621 598..1218 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:39:58 Download gff for MIP06293.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RO 1..621 598..1218 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:39:35 Download gff for MIP06293.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RO 1..621 598..1218 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:57:26 Download gff for MIP06293.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RI 163..2142 362..2335 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:43:28 Download gff for MIP06293.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RO 1..2335 1..2335 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:39:58 Download gff for MIP06293.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RO 29..2363 1..2335 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:39:35 Download gff for MIP06293.complete
Subject Subject Range Query Range Percent Splice Strand
dlg1-RO 29..2363 1..2335 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:39:35 Download gff for MIP06293.complete
Subject Subject Range Query Range Percent Splice Strand
X 11387992..11389296 1036..2340 100   Plus
X 11387772..11387933 874..1035 100 -> Plus
X 11381856..11381980 749..873 100 -> Plus
X 11376842..11376973 617..748 100 -> Plus
X 11374257..11374510 363..616 100 -> Plus
X 11373817..11374088 91..362 100 -> Plus
X 11373053..11373142 1..90 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:39:58 Download gff for MIP06293.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11282025..11283329 1036..2340 100   Plus
arm_X 11281805..11281966 874..1035 100 -> Plus
arm_X 11275889..11276013 749..873 100 -> Plus
arm_X 11270875..11271006 617..748 100 -> Plus
arm_X 11268290..11268543 363..616 100 -> Plus
arm_X 11267850..11268121 91..362 100 -> Plus
arm_X 11267086..11267175 1..90 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:18:28 Download gff for MIP06293.complete
Subject Subject Range Query Range Percent Splice Strand
X 11396090..11397394 1036..2340 100   Plus
X 11395870..11396031 874..1035 100 -> Plus
X 11389954..11390078 749..873 100 -> Plus
X 11384940..11385071 617..748 100 -> Plus
X 11382355..11382608 363..616 100 -> Plus
X 11381915..11382186 91..362 100 -> Plus
X 11381151..11381240 1..90 100 -> Plus

MIP06293.pep Sequence

Translation from 597 to 1217

> MIP06293.pep
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTVEQQQKQQQAQQRSSRSPQQQNPQQQQGSKSRSGSQTIQIQ
SLTQTYPNAHQRKRVLVSLHPHQHQHQSQIQHQHHYQLRHNNGIQAKMLK
RAFEST*

MIP06293.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:01:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19076-PA 567 GF19076-PA 344..430 6..92 453 98.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18413-PA 567 GG18413-PA 301..387 6..92 453 98.9 Plus
Dere\GG18413-PA 567 GG18413-PA 447..567 93..206 204 61.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:01:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12184-PA 216 GH12184-PA 1..178 1..127 507 61.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:01:32
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-PO 206 CG1725-PO 1..206 1..206 1046 100 Plus
dlg1-PI 208 CG1725-PI 1..208 1..206 1033 99 Plus
dlg1-PJ 208 CG1725-PJ 1..208 1..206 1033 99 Plus
dlg1-PC 208 CG1725-PC 1..208 1..206 1033 99 Plus
dlg1-PU 198 CG1725-PU 1..198 1..206 991 96.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:01:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15715-PA 497 GI15715-PA 288..379 1..92 452 94.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:01:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14854-PA 213 GL14854-PA 1..213 1..206 606 66.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:01:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14413-PA 578 GA14413-PA 308..394 6..92 452 98.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:01:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11477-PA 403 GM11477-PA 302..392 6..96 454 95.6 Plus
Dsec\GM13074-PA 178 GM13074-PA 60..178 93..206 313 89.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:01:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17020-PA 298 GD17020-PA 1..262 1..203 524 62.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:01:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15243-PA 206 GJ15243-PA 1..92 1..92 480 98.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:01:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16228-PA 265 GK16228-PA 1..92 1..92 481 96.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:01:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15930-PA 274 GE15930-PA 1..92 1..92 492 100 Plus

MIP06293.hyp Sequence

Translation from 597 to 1217

> MIP06293.hyp
MPVKKQEAHRALELLEDYHARLSEPQDRALRIAIERVIRIFKSRLFQALL
DIQEFYELTLLDDSKSIQQKTAETLQIATKWEKDGQAVKIADNQRMRIES
DTENAKEPTVEQQQKQQQAQQRSSRSPQQQNPQQQQGSKSRSGSQTIQIQ
SLTQTYPNAHQRKRVLVSLHPHQHQHQSQIQHQHHYQLRHNNGIQAKMLK
RAFEST*

MIP06293.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:54:50
Subject Length Description Subject Range Query Range Score Percent Strand
dlg1-PO 206 CG1725-PO 1..206 1..206 1046 100 Plus
dlg1-PI 208 CG1725-PI 1..208 1..206 1033 99 Plus
dlg1-PJ 208 CG1725-PJ 1..208 1..206 1033 99 Plus
dlg1-PC 208 CG1725-PC 1..208 1..206 1033 99 Plus
dlg1-PU 198 CG1725-PU 1..198 1..206 991 96.1 Plus