Clone MIP06306 Report

Search the DGRC for MIP06306

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:63
Well:6
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43077-RA
Protein status:MIP06306.pep: gold
Sequenced Size:1032

Clone Sequence Records

MIP06306.complete Sequence

1032 bp assembled on 2009-02-20

GenBank Submission: BT064660.1

> MIP06306.complete
TAAACGAAAGTCATACGAAAAAATCTCTAACAACATAATAATATTTTTGA
TTTTCGATTCTGAACAATGAATAAAATGGAAGAAAACTTCTACAATGGAT
GCACTTGTTGCCATTGCTCTTGCCGCCGCTCTTGCTCTTGCTCGTCTTTA
AAACGATGCAATTCCGCTGAATCGTGTCGCTTACTTATTCAGAAAAGTTC
GAAATATATATACGATGGCGTTAGATGCTCAGATCTCAGATGTCCATACT
GCAACGAAGCGCTTGGACAGAAAATCCTTTTATCGCACTCGGCGGAGTCC
ACTGCTCGAACGCCACAACAAACGCGGATTTCCGACATACAGTTTAGTCA
TTCGGATAAAGGACGAAAAAGTTACAGTAAAATGAAATCGATGTCCGGAT
TTGAAGAGCCTAAAGATCAAGTTCAATATAAGAAGAGAGAGTCTAGCATA
TCAACACCATTCAGTTGCTATAGGGAGGATTCGCCAAGGTCCTCGTCCAG
AGTTAAGTCTACCGGAAAGTACAGTTGCAACTGCTTCACAAAGGAACAGC
CAAGAAAGTATGTTTCAAAGACTGCCGAAGAAATCAGAAGGACGGTTCGA
GCGGAGATTGCAGAGATGGAGCAAAAGCAGGCAATGGCAGACAAAAATGG
ATGTGATTTTACTTTTTGCAAGCCACCGCAGAGTGGACGATTGTCATCTA
ATGAAGAAACCAAGAGTAAATCTAAAGATGAAGAGATTTTTACGGAGTCC
GAGAAATTGATACTTAGCAAAATTGATTGGCGTACTACTGCCACCAATGA
TTTGTCTAATTCCGAGGTAATTTATTCGACGATAAAGCGCTTGCTGCGCG
TATGTCTGAACAACAAGATAATCGAACTTGGGCTCCTGGATAGTCTGCAT
GATGCGATAGCACAATTCAAACGAGACAACTAATAGGATTCCTTTTTTAT
TTTTGTGTATATTTTTTATAATTAAATTTGGGGTAACAGGGGGGAAACAT
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP06306.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:29
Subject Length Description Subject Range Query Range Score Percent Strand
nc_24320.a 994 nc_24320.a 1..994 1..994 4970 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:18:49
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 16956812..16957484 1000..327 3290 99.6 Minus
chrX 22417052 chrX 16957638..16957811 327..154 870 100 Minus
chrX 22417052 chrX 16957878..16958030 153..1 765 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:18:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG43077-RA 867 CG43077-PA 1..867 67..933 4335 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:06:45 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:18:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG43077-RA 1000 CG43077-RA 1..1000 1..1000 5000 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG43077-PA 288 CG43077-PA 1..288 67..930 1355 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17067303..17067977 1001..327 3375 100 Minus
X 23542271 X 17068131..17068304 327..154 870 100 Minus
X 23542271 X 17068371..17068523 153..1 765 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:32
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 17075401..17076075 1001..327 3375 100 Minus
X 23527363 X 17076229..17076402 327..154 870 100 Minus
X 23527363 X 17076469..17076621 153..1 765 100 Minus
Blast to na_te.dros performed on 2014-11-26 19:18:45 has no hits.

MIP06306.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:28:52 Download gff for MIP06306.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 16957878..16958030 1..153 100   Minus
chrX 16957638..16957811 154..327 100 <- Minus
chrX 16956812..16957483 328..1000 94 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:36:49 Download gff for MIP06306.complete
Subject Subject Range Query Range Percent Splice Strand
CG43077-RA 1..867 67..933 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:17:03 Download gff for MIP06306.complete
Subject Subject Range Query Range Percent Splice Strand
CG43077-RA 1..867 67..933 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:28:52 Download gff for MIP06306.complete
Subject Subject Range Query Range Percent Splice Strand
CG43077-RA 1..867 67..933 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:36:48 Download gff for MIP06306.complete
Subject Subject Range Query Range Percent Splice Strand
CG43077-RA 1..1000 1..1000 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:17:03 Download gff for MIP06306.complete
Subject Subject Range Query Range Percent Splice Strand
CG43077-RA 1..1000 1..1000 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:28:52 Download gff for MIP06306.complete
Subject Subject Range Query Range Percent Splice Strand
CG43077-RA 1..1000 1..1000 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:28:52 Download gff for MIP06306.complete
Subject Subject Range Query Range Percent Splice Strand
X 17068371..17068523 1..153 100   Minus
X 17068131..17068304 154..327 100 <- Minus
X 17067304..17067976 328..1000 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:17:03 Download gff for MIP06306.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 16962404..16962556 1..153 100   Minus
arm_X 16962164..16962337 154..327 100 <- Minus
arm_X 16961337..16962009 328..1000 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:10:28 Download gff for MIP06306.complete
Subject Subject Range Query Range Percent Splice Strand
X 17076469..17076621 1..153 100   Minus
X 17076229..17076402 154..327 100 <- Minus
X 17075402..17076074 328..1000 100 <- Minus

MIP06306.pep Sequence

Translation from 66 to 932

> MIP06306.pep
MNKMEENFYNGCTCCHCSCRRSCSCSSLKRCNSAESCRLLIQKSSKYIYD
GVRCSDLRCPYCNEALGQKILLSHSAESTARTPQQTRISDIQFSHSDKGR
KSYSKMKSMSGFEEPKDQVQYKKRESSISTPFSCYREDSPRSSSRVKSTG
KYSCNCFTKEQPRKYVSKTAEEIRRTVRAEIAEMEQKQAMADKNGCDFTF
CKPPQSGRLSSNEETKSKSKDEEIFTESEKLILSKIDWRTTATNDLSNSE
VIYSTIKRLLRVCLNNKIIELGLLDSLHDAIAQFKRDN*

MIP06306.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 16:45:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18207-PA 313 GG18207-PA 44..305 42..285 303 41.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 16:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG43077-PA 288 CG43077-PA 1..288 1..288 1516 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 16:45:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15625-PA 240 GE15625-PA 122..240 162..288 173 39.4 Plus

MIP06306.hyp Sequence

Translation from 66 to 932

> MIP06306.hyp
MNKMEENFYNGCTCCHCSCRRSCSCSSLKRCNSAESCRLLIQKSSKYIYD
GVRCSDLRCPYCNEALGQKILLSHSAESTARTPQQTRISDIQFSHSDKGR
KSYSKMKSMSGFEEPKDQVQYKKRESSISTPFSCYREDSPRSSSRVKSTG
KYSCNCFTKEQPRKYVSKTAEEIRRTVRAEIAEMEQKQAMADKNGCDFTF
CKPPQSGRLSSNEETKSKSKDEEIFTESEKLILSKIDWRTTATNDLSNSE
VIYSTIKRLLRVCLNNKIIELGLLDSLHDAIAQFKRDN*

MIP06306.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:03:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG43077-PA 288 CG43077-PA 1..288 1..288 1516 100 Plus