Clone MIP06385 Report

Search the DGRC for MIP06385

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:63
Well:85
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43110-RA
Protein status:MIP06385.pep: gold
Sequenced Size:1664

Clone Sequence Records

MIP06385.complete Sequence

1664 bp assembled on 2009-02-21

GenBank Submission: BT066320.1

> MIP06385.complete
ATGACGTATCTTTTTGTGTGGATTTTTTTGTGCTCATTGGGATCTTGCCA
GTTGGCGTATTCCATGTTTTTGAAGCAGCCCTGTGGAAAAACACCAGTCC
CGAAAATTATTTCAGGCTCAAACGCAAGTCAACAAAGTGCTCAGTATATG
GCAGGCATTTTTAATACAACACATTTGTTGTGCGGCGGCACGATTATTCA
CGAAGATTTTGTTTTAACGGTTGCTCATTGCAAAAGTACACAAACGCTAT
TCGTGAGACTTGGAGCGTACAACATTAATCACCCGACCGATCAGATTCGC
GTAATCGAAACTATAGCCCATCCACAATACAGCAATTCCACTTATGCCAA
CGATATAGCCCTGGTGAAGTTGGAGAGGAGTGTGATATTTAACCTTAATA
TTCAACCAATATGCATTCACTTGGACGCAACATTGGGCAAACAAATACGC
TATTATAATGCCTTTGGATGGGGAAGAACAAGAAATGCCGAGCAAAGCGA
TATACTTCAAAGAATTTTTGTTAATCGAACCAACCCAATGATATGCCATC
TCTATTTGGGAATGAGTCCCGATCCGAAACAGATATGTGCGACTACCGAC
CAAGGAGATACATGTGCCGGCGATTCTGGCGGTCCGTTGATCAGCAAAAT
TACTTACCAGGGGAAGAATTTCGATACACAGTTCGGGATTACCAGTTATG
GCACCAGGGAATGCAATGGAGTTGGTCTCTATACCGATGTCTCACAGTAT
AGTGGCTGGATTGCAAATATAGTTAGGAGCAAACAGGATCGTAGTGTGGT
CAGTAGGAGGAGCAACGGTATGTTTCTGTATTCTGACTGCACTGGCGATT
CCATCGGATCCATTCTAATGGCAACCATCGTTGGACTTCAATACTCCGCG
AAGGGTGTACTGATCACCGACCGCCATGTCCTAACCACTGCGGACTTTTC
CCAAGACAACCCCTTCTCCTTAGCCATTGTTGTGATGGGTATGGAATTCC
AAGCTAGCGCGATTTTTAAGCCGTTTGCGGACATTAACATATCACTGATT
AGCCTGACGCGTCGGTTGGAAAACAGAGGTGCATTGAGACCGATCTGCAT
TCTGGAAACTGCAAACATCGCTGGTTCTTTAAGAATCACTGGCACAGGTC
AATATGGCTTAAGCAATTACGTTATAAATGTGCAAAGCCTTAATTGGCAG
TTGTGTGAACTTGAGTTGAGGAGAAATATCGAACAGAATCAGTTTTGTGT
GAAAAACACTTTCCAACCAAATGCGCTTAAGCAATTTGGTACAGCTGGCG
ATATATTGGTTAAAAAAATATTGAATGTTTCGGGCATGGTCCATTTCGTT
CTATTGGGCTTGGTAGACGTTTCGCACAATGACGTATACGTAATAACCAG
TGCTATGGCAAATGCAGAATGGATCTCGAAAATAGTAAATCAGAATGAAT
AGGGTATCTGGATTATCGGGCGATTTAATCGAAAACTACACAAGCAGTAA
ATAAATTTAAACACAATATCATTTCAGTTCTCACAACATTTATTAGCTAT
TTAGTTTAAGTTTGTGTGTGAAACAAGCATATATTATATTAATTAAGGGC
AAACTTATCACCAATCACACTTGACTCTTTAAGTCGAAAAAATGCAAAAA
AAAAAAAAAAAAAA

MIP06385.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
MB7.chr2R.pasa.4777.b 1647 MB7.chr2R.pasa.4777.b 12..1647 1..1636 8180 100 Plus
MB7.chr2R.pasa.4777.c 1922 MB7.chr2R.pasa.4777.c 287..1922 1..1636 8180 100 Plus
MB7.chr2R.pasa.4777.a 1689 MB7.chr2R.pasa.4777.a 41..962 1..922 4610 100 Plus
MB7.chr2R.pasa.4777.a 1689 MB7.chr2R.pasa.4777.a 976..1689 923..1636 3570 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:42:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13369068..13369637 1645..1077 2770 99.5 Minus
chr2R 21145070 chr2R 13369976..13370504 923..395 2615 99.6 Minus
chr2R 21145070 chr2R 13370893..13371097 205..1 1010 99.5 Minus
chr2R 21145070 chr2R 13370563..13370708 394..249 730 100 Minus
chr2R 21145070 chr2R 13369688..13369796 1080..972 545 100 Minus
chr2R 21145070 chr2R 13369862..13369910 971..923 245 100 Minus
chr2R 21145070 chr2R 13370769..13370813 248..204 225 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:42:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG43110-RA 1452 CG43110-PA 1..1452 1..1452 7260 100 Plus
CG43110-RB 1452 CG43110-PB 1..1452 1..1452 7260 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:07:00 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG43110-RA 1671 CG43110-RA 27..1671 1..1645 8225 100 Plus
CG43110-RB 8272 CG43110-RB 2195..3839 1..1645 8225 100 Plus
veil-RB 2220 CG4827-RB 2100..2220 1645..1525 605 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:42:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG43110-PA 483 CG43110-PA 1..483 1..1449 2518 100 Plus
CG43110-PB 483 CG43110-PB 1..483 1..1449 2518 100 Plus
CG30187-PD 451 CG30187-PD 1..451 148..1446 659 35.4 Plus
CG30187-PC 440 CG30187-PC 1..440 148..1446 626 34.6 Plus
CG10764-PA 523 CG10764-PA 25..516 67..1437 596 32 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17481996..17482566 1647..1077 2855 100 Minus
2R 25286936 2R 17482905..17483433 923..395 2645 100 Minus
2R 25286936 2R 17483822..17484026 205..1 1025 100 Minus
2R 25286936 2R 17483492..17483637 394..249 730 100 Minus
2R 25286936 2R 17482617..17482725 1080..972 545 100 Minus
2R 25286936 2R 17482791..17482839 971..923 245 100 Minus
2R 25286936 2R 17483698..17483742 248..204 225 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17483195..17483765 1647..1077 2855 100 Minus
2R 25260384 2R 17484104..17484632 923..395 2645 100 Minus
2R 25260384 2R 17485021..17485225 205..1 1025 100 Minus
2R 25260384 2R 17484691..17484836 394..249 730 100 Minus
2R 25260384 2R 17483816..17483924 1080..972 545 100 Minus
2R 25260384 2R 17483990..17484038 971..923 245 100 Minus
2R 25260384 2R 17484897..17484941 248..204 225 100 Minus
Blast to na_te.dros performed on 2014-11-27 10:42:44 has no hits.

MIP06385.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:48:40 Download gff for MIP06385.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13370893..13371097 1..205 99   Minus
chr2R 13370769..13370811 206..248 100 <- Minus
chr2R 13370563..13370708 249..394 100 <- Minus
chr2R 13369977..13370504 395..922 99 <- Minus
chr2R 13369862..13369910 923..971 100 <- Minus
chr2R 13369690..13369796 972..1078 100 <- Minus
chr2R 13369068..13369635 1079..1645 99 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:37:28 Download gff for MIP06385.complete
Subject Subject Range Query Range Percent Splice Strand
CG43110-RA 1..1452 1..1452 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:18:56 Download gff for MIP06385.complete
Subject Subject Range Query Range Percent Splice Strand
CG43110-RA 1..1452 1..1452 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:48:40 Download gff for MIP06385.complete
Subject Subject Range Query Range Percent Splice Strand
CG43110-RB 1..1452 1..1452 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-02-21 17:17:33 Download gff for MIP06385.complete
Subject Subject Range Query Range Percent Splice Strand
CG4827-RA 1924..2054 1515..1645 100   Minus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:37:27 Download gff for MIP06385.complete
Subject Subject Range Query Range Percent Splice Strand
CG43110-RA 1..1645 1..1645 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:18:56 Download gff for MIP06385.complete
Subject Subject Range Query Range Percent Splice Strand
CG43110-RA 27..1671 1..1645 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:48:40 Download gff for MIP06385.complete
Subject Subject Range Query Range Percent Splice Strand
CG43110-RB 2195..3839 1..1645 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:48:40 Download gff for MIP06385.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17483822..17484026 1..205 100   Minus
2R 17483698..17483740 206..248 100 <- Minus
2R 17483492..17483637 249..394 100 <- Minus
2R 17482906..17483433 395..922 100 <- Minus
2R 17482791..17482839 923..971 100 <- Minus
2R 17482619..17482725 972..1078 100 <- Minus
2R 17481998..17482564 1079..1645 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:18:56 Download gff for MIP06385.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13371327..13371531 1..205 100   Minus
arm_2R 13371203..13371245 206..248 100 <- Minus
arm_2R 13370997..13371142 249..394 100 <- Minus
arm_2R 13370411..13370938 395..922 100 <- Minus
arm_2R 13370296..13370344 923..971 100 <- Minus
arm_2R 13370124..13370230 972..1078 100 <- Minus
arm_2R 13369503..13370069 1079..1645 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:11:14 Download gff for MIP06385.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17485021..17485225 1..205 100   Minus
2R 17484897..17484939 206..248 100 <- Minus
2R 17484691..17484836 249..394 100 <- Minus
2R 17484105..17484632 395..922 100 <- Minus
2R 17483990..17484038 923..971 100 <- Minus
2R 17483818..17483924 972..1078 100 <- Minus
2R 17483197..17483763 1079..1645 100 <- Minus

MIP06385.pep Sequence

Translation from 0 to 1451

> MIP06385.pep
MTYLFVWIFLCSLGSCQLAYSMFLKQPCGKTPVPKIISGSNASQQSAQYM
AGIFNTTHLLCGGTIIHEDFVLTVAHCKSTQTLFVRLGAYNINHPTDQIR
VIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDATLGKQIR
YYNAFGWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQICATTD
QGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGLYTDVSQY
SGWIANIVRSKQDRSVVSRRSNGMFLYSDCTGDSIGSILMATIVGLQYSA
KGVLITDRHVLTTADFSQDNPFSLAIVVMGMEFQASAIFKPFADINISLI
SLTRRLENRGALRPICILETANIAGSLRITGTGQYGLSNYVINVQSLNWQ
LCELELRRNIEQNQFCVKNTFQPNALKQFGTAGDILVKKILNVSGMVHFV
LLGLVDVSHNDVYVITSAMANAEWISKIVNQNE*

MIP06385.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 16:36:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11318-PA 308 GF11318-PA 1..214 50..258 463 43.5 Plus
Dana\GF13370-PA 505 GF13370-PA 7..503 21..481 396 28.9 Plus
Dana\GF15010-PA 628 GF15010-PA 407..627 61..262 371 38.7 Plus
Dana\GF12091-PA 280 GF12091-PA 6..277 6..272 370 33.5 Plus
Dana\GF11497-PA 284 GF11497-PA 21..271 23..257 311 34.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 16:36:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20542-PA 281 GG20542-PA 10..278 4..260 415 34.6 Plus
Dere\GG20540-PA 291 GG20540-PA 17..280 16..261 394 36.4 Plus
Dere\GG20543-PA 280 GG20543-PA 23..276 21..259 387 34.5 Plus
Dere\GG24240-PA 374 GG24240-PA 21..277 21..259 346 33.1 Plus
Dere\GG16535-PA 281 GG16535-PA 5..279 9..262 340 31.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 16:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20292-PA 242 GH20292-PA 21..237 61..256 333 36.9 Plus
Dgri\GH20291-PA 237 GH20291-PA 16..232 61..256 329 36.9 Plus
Dgri\GH23917-PA 235 GH23917-PA 32..230 61..256 314 38.9 Plus
Dgri\GH19627-PA 370 GH19627-PA 146..365 59..254 286 35 Plus
Dgri\GH19618-PA 388 GH19618-PA 164..383 59..254 280 34.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 16:36:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG43110-PA 483 CG43110-PA 1..483 1..483 2518 100 Plus
CG43110-PB 483 CG43110-PB 1..483 1..483 2518 100 Plus
CG30187-PD 451 CG30187-PD 1..451 50..482 659 35.4 Plus
CG30187-PC 440 CG30187-PC 1..440 50..482 626 34.6 Plus
CG10764-PA 523 CG10764-PA 25..516 23..479 596 32 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 16:36:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22268-PA 380 GI22268-PA 154..379 59..258 296 33.5 Plus
Dmoj\GI23202-PA 376 GI23202-PA 110..371 28..258 293 30.9 Plus
Dmoj\GI17616-PA 540 GI17616-PA 288..535 28..254 285 35.5 Plus
Dmoj\GI24320-PA 447 GI24320-PA 179..446 28..259 262 29.8 Plus
Dmoj\GI16701-PA 290 GI16701-PA 42..288 31..269 260 33.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 16:36:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11858-PA 345 GL11858-PA 9..283 8..259 445 36.7 Plus
Dper\GL11857-PA 283 GL11857-PA 14..280 8..262 409 36.6 Plus
Dper\GL17488-PA 282 GL17488-PA 10..280 8..261 402 35.3 Plus
Dper\GL10743-PA 279 GL10743-PA 6..278 4..262 381 33.3 Plus
Dper\GL17487-PA 304 GL17487-PA 40..289 11..269 369 35.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 16:36:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25145-PA 345 GA25145-PA 8..283 6..259 455 37.5 Plus
Dpse\GA15642-PA 283 GA15642-PA 14..280 8..262 404 35.9 Plus
Dpse\GA24176-PA 282 GA24176-PA 10..280 8..261 399 35.3 Plus
Dpse\GA24468-PA 278 GA24468-PA 7..277 4..262 395 33.2 Plus
Dpse\GA24175-PB 304 GA24175-PB 40..289 11..269 367 35.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 16:36:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21775-PA 510 GM21775-PA 19..510 17..479 582 33 Plus
Dsec\GM21629-PA 520 GM21629-PA 8..519 4..478 426 27.1 Plus
Dsec\GM21631-PA 291 GM21631-PA 16..278 10..259 425 39.2 Plus
Dsec\GM20123-PA 263 GM20123-PA 2..250 21..265 406 37.7 Plus
Dsec\GM21633-PA 279 GM21633-PA 7..270 5..254 404 35.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 16:36:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11268-PA 509 GD11268-PA 19..509 17..479 595 33.2 Plus
Dsim\GD25474-PA 145 GD25474-PA 1..145 180..324 583 73.8 Plus
Dsim\GD11133-PA 295 GD11133-PA 16..278 10..259 423 38.4 Plus
Dsim\GD11131-PA 515 GD11131-PA 9..514 21..480 420 29.7 Plus
Dsim\GD25600-PA 263 GD25600-PA 2..250 21..265 409 37.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 16:36:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21212-PA 268 GJ21212-PA 2..267 21..260 351 35.3 Plus
Dvir\GJ21978-PA 296 GJ21978-PA 35..292 26..258 329 32.2 Plus
Dvir\GJ21214-PA 280 GJ21214-PA 2..277 9..258 324 33 Plus
Dvir\GJ24059-PA 397 GJ24059-PA 139..392 28..254 312 34.6 Plus
Dvir\GJ22863-PA 372 GJ22863-PA 106..365 28..256 263 29.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 16:36:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23933-PA 280 GK23933-PA 35..249 59..250 284 34.1 Plus
Dwil\GK11884-PA 375 GK11884-PA 100..370 21..258 279 29.9 Plus
Dwil\GK22647-PA 279 GK22647-PA 55..278 58..259 274 33.3 Plus
Dwil\GK20445-PA 263 GK20445-PA 11..262 34..261 270 31.7 Plus
Dwil\GK20792-PA 360 GK20792-PA 93..357 24..258 267 31.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 16:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11663-PA 516 GE11663-PA 23..516 21..479 607 32.2 Plus
Dyak\GE11725-PA 296 GE11725-PA 16..277 10..261 458 38.6 Plus
Dyak\GE11723-PA 522 GE11723-PA 6..509 21..478 429 29.1 Plus
Dyak\GE11726-PA 282 GE11726-PA 44..279 35..260 405 35.9 Plus
Dyak\GE11727-PA 280 GE11727-PA 10..271 8..254 402 36.1 Plus

MIP06385.hyp Sequence

Translation from 1 to 1451

> MIP06385.hyp
MTYLFVWIFLCSLGSCQLAYSMFLKQPCGKTPVPKIISGSNASQQSAQYM
AGIFNTTHLLCGGTIIHEDFVLTVAHCKSTQTLFVRLGAYNINHPTDQIR
VIETIAHPQYSNSTYANDIALVKLERSVIFNLNIQPICIHLDATLGKQIR
YYNAFGWGRTRNAEQSDILQRIFVNRTNPMICHLYLGMSPDPKQICATTD
QGDTCAGDSGGPLISKITYQGKNFDTQFGITSYGTRECNGVGLYTDVSQY
SGWIANIVRSKQDRSVVSRRSNGMFLYSDCTGDSIGSILMATIVGLQYSA
KGVLITDRHVLTTADFSQDNPFSLAIVVMGMEFQASAIFKPFADINISLI
SLTRRLENRGALRPICILETANIAGSLRITGTGQYGLSNYVINVQSLNWQ
LCELELRRNIEQNQFCVKNTFQPNALKQFGTAGDILVKKILNVSGMVHFV
LLGLVDVSHNDVYVITSAMANAEWISKIVNQNE*

MIP06385.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG43110-PA 483 CG43110-PA 1..483 1..483 2518 100 Plus
CG43110-PB 483 CG43110-PB 1..483 1..483 2518 100 Plus
CG30187-PD 451 CG30187-PD 1..451 50..482 659 35.4 Plus
CG30187-PC 440 CG30187-PC 1..440 50..482 626 34.6 Plus
CG10764-PA 523 CG10764-PA 25..516 23..479 596 32 Plus