Clone MIP06652 Report

Search the DGRC for MIP06652

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:66
Well:52
Vector:pOT2
Associated Gene/Transcriptbrv1-RA
Protein status:MIP06652.pep: gold
Sequenced Size:2690

Clone Sequence Records

MIP06652.complete Sequence

2690 bp assembled on 2009-07-02

GenBank Submission: BT088910.1

> MIP06652.complete
AGAGGCTCAACTAAAGCTTGATAACAGCAATGGCGAAGAAGTTTAGTAAC
ATAATATTCTATCTGACCCTGATAATCATAGCCATCTGTGTGGCCTGTAT
CTGGATGTTCTCGGGCTTCCGTCACGAATATGGCAAATTCAACATGATCC
TGGTTGCCTTCTTGGCCGTTACTTTACTTCAGATCCTAATCTTTACGCCC
ATTAAGTTCACAATTATGTCGCTGGATGCCGCCTTCTGGCCGGCCCACCA
AGCACCGGAGACTCCCGACGAGAATGCCAATGTGGACACGTTCATGGACA
ATCTCAGACTGCGCCTCCGGACGCTGCGGAGTGAGCTGATGATCACGGAG
AGGCATCGGAACGAGAGGGTCAACCTGAAGTATCGCCTGATTACCGAGGA
ACTTTGGCTCACGGGCAAGCTGTTCCTGGTTTACTTCTTCATGGCCTTGG
CTTTCTTCGATGAGTTGCTGTACTTTAACACAGAGGCCACGGAGTTACTG
TTCCAATGTAATCATGGGGATGCGTTCGGACTATTGAGTGTGGGGGATGT
GCCGGATATATATTTTTTTGTGGTGTCCTCGTTAGTGCTGGCCTTTACGG
ATGGCAAGAACACCAGTGGCGGAGCTCCTTGGATCCATGCGGAGGGCACT
AGACTACTGGGCGTGGTGAGACTGAGGCAGCTGAGGACAGAGAGCAACCG
ATTGGGTCTATCGCTTCCTGTGTTCACTGAGCGGGACTTTTCGGAGAGCT
GGACACTGCCCTACGAAAGGGTTCCCTATACGGACAAGTACTGGCCCATC
TACACACCCTGGCTGCCCAGTGTTTCTGTTGCTCGGGACAACCTACTTAT
GGGCATTAACCACGTGGGGCACATGTTCAACTATCCGGAATCGAAGGGCT
ACAAGGTACTGCTCTCGGACACCCGCCACAAAAGCCTGAAAATTATTGAT
TACTTGATGAAGAAAAACTGGCTGGATGCGAATACGACCGCTTTGTTCAT
GGATTTCAGCTTGTACAACGCGGATGCCAACACCTTTACCGTGTGCACCT
TGTGGGTGGAAAAGTTCCCTTACCAGTATCCTGATGGCCACACGAGGATC
GAGAGTCACACCTTTGTGGAGCAACTGCGAGAGTTTACGAAGTTCGGAAT
GCTAATGGTGTTTGTCTTTGTCGTCACGTGGCTGCAGTTCACCAAGGCGT
TCTTCCTGAAGGTCTGGTACGATCCTCGACAGTTGAAGACCCTGTGGGTC
CAGGTGGATGCAATGATCGTGGCACTCAGCCTCGTTGTGGGGATGATCAT
GTCGGTGCGGGATAACTTGGTTCAAAAGATGATCAAGAGTGTTGAAATCG
CCGTTGTGGTGGACTTTCTGGACTTTCGGGAGCCAGCCCAGCTCGCCTAC
CTTGAGGATGTGGTCACGGGATTGGCCGTGGCCTTGGTCACTATGCGTTT
GTGGAAAGTGTTGCAGTTTTCCGCCACCTTCCAACTGTTCACCAAGACAA
TCGCTATGGCGTGGGACGCGTTGCTCTGCACCTTCGTAATAACCGTGATT
TTCATCATTGCAATTGGCATTGCGACGGTAACCATCAATGGCAACTATAC
CAGCAACTTCAGGGACTTCCCCAAGGGCATTGTTACGGTCACCTGCTTTG
CCTTTGGCTATACGAATTTGGTATACCCACCGGATATCTTTTACGGCGGA
GAGTGGCTGGGCATCTTATTGTATACCATAATGGGATTCGTGGTCAAGTA
CATGCTGATCAACTTGATCGTTTCCATGATGAGGGATCAGATGGCCAGTG
TCAAGGCGGATAGGGATAAGAAAGTGAGGCAGCGCATAACATTCTGGCAA
TTCCTGCGCGTTGAATATGCCCACTTTATTAACTACATCGTAAAAGTGTT
CCACTGCCAAAAGGGATATCAGCGAAAGAATCGCACAGTTGCACAGAACA
TCCAACGAAAACTGAATAGTAATGAGCTTAAGCGACGAAAGACGAAGATT
AGTTCAATTTATTCCGAGACAATATATGTCATGCCGATAGACAAGGATCT
GGAGCAGATGAAATATAGGGAGCGGATCGAGCGAACCTTCACTCTGGCCG
CCATCCTCCACACCCAAATGGAGCTCATGGAGAGGCTTATGTTCGGTGAC
GAAGAGGGGAACCTGCCAAGTTTGGACCAGGAAGACGAGCAGGTTCCAGA
GACTGAGGAGGACTGAAGAACGACAGCTTAACTGCAGTTTATACAGTGCA
AGGGATCATAGGGATTCTAAGAGATTCATGTGAAATAGAACTTATGGTAG
TACCTTCATCAAGGTAAAATGATGATGTGTACATACGTGATGTTTGGTAA
CATTTTCTGCACAGTTGAAACCAAATCTCGGCAAAAGTCCCTAATAGTTA
AACACTACTTAGGATAGTTTTGCAGGATCCTTCCCCATCCGTGCAGTTTT
GTGATTTTTTGTTTATGTCACGGCTAAATAATTATGCGCAAACAGGCAAA
ACTTTTGACTTGAAAAGGCTTTTAGGGCAATTTGGCGCTTGCTTTGTTCG
GCCTGTTTGCCATCCGAGGATTCTGGCTGAGCTCCAAGTGCCCGAACCAA
GTGACTTATAAAAGGGGGAGTGGCACAGCCCTCACTATTGTTATGAAGTA
AGCAAATAAAAATTTAATACTGCAAAAAAAAAAAAAAAAA

MIP06652.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG9472-RA 2673 CG9472-RA 1..2673 1..2673 13365 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:49:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 19473261..19475933 2673..1 13305 99.9 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
brv1-RA 2187 CG9472-PA 1..2187 30..2216 10935 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:07:24 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
brv1-RA 2673 CG9472-RA 1..2673 1..2673 13365 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:49:14
Subject Length Description Subject Range Query Range Score Percent Strand
brv1-PA 728 CG9472-PA 1..728 30..2213 3488 100 Plus
brv3-PC 750 CG13762-PC 21..728 87..2210 1195 38 Plus
brv3-PB 719 CG13762-PB 21..658 87..1985 1164 40 Plus
brv2-PA 736 CG16793-PA 24..730 87..2201 1005 35.1 Plus
brv2-PB 714 CG16793-PB 20..708 144..2201 944 34.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19483824..19486498 2675..1 13375 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 19476924..19479598 2675..1 13375 100 Minus
Blast to na_te.dros performed on 2014-11-27 08:49:08 has no hits.

MIP06652.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:16:03 Download gff for MIP06652.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 19473261..19475933 1..2673 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:26 Download gff for MIP06652.complete
Subject Subject Range Query Range Percent Splice Strand
CG9472-RA 1..2187 30..2216 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:49:40 Download gff for MIP06652.complete
Subject Subject Range Query Range Percent Splice Strand
CG9472-RA 1..2187 30..2216 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:55:11 Download gff for MIP06652.complete
Subject Subject Range Query Range Percent Splice Strand
brv1-RA 1..2187 30..2216 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:16:03 Download gff for MIP06652.complete
Subject Subject Range Query Range Percent Splice Strand
brv1-RA 1..2187 30..2216 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-02 15:54:52 Download gff for MIP06652.complete
Subject Subject Range Query Range Percent Splice Strand
CG9472-RA 1..2187 30..2216 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:49:39 Download gff for MIP06652.complete
Subject Subject Range Query Range Percent Splice Strand
CG9472-RA 1..2673 1..2673 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:55:11 Download gff for MIP06652.complete
Subject Subject Range Query Range Percent Splice Strand
brv1-RA 1..2673 1..2673 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:16:03 Download gff for MIP06652.complete
Subject Subject Range Query Range Percent Splice Strand
brv1-RA 1..2673 1..2673 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:16:03 Download gff for MIP06652.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19483826..19486498 1..2673 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:55:11 Download gff for MIP06652.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19476926..19479598 1..2673 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:25:26 Download gff for MIP06652.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19476926..19479598 1..2673 100   Minus

MIP06652.pep Sequence

Translation from 29 to 2215

> MIP06652.pep
MAKKFSNIIFYLTLIIIAICVACIWMFSGFRHEYGKFNMILVAFLAVTLL
QILIFTPIKFTIMSLDAAFWPAHQAPETPDENANVDTFMDNLRLRLRTLR
SELMITERHRNERVNLKYRLITEELWLTGKLFLVYFFMALAFFDELLYFN
TEATELLFQCNHGDAFGLLSVGDVPDIYFFVVSSLVLAFTDGKNTSGGAP
WIHAEGTRLLGVVRLRQLRTESNRLGLSLPVFTERDFSESWTLPYERVPY
TDKYWPIYTPWLPSVSVARDNLLMGINHVGHMFNYPESKGYKVLLSDTRH
KSLKIIDYLMKKNWLDANTTALFMDFSLYNADANTFTVCTLWVEKFPYQY
PDGHTRIESHTFVEQLREFTKFGMLMVFVFVVTWLQFTKAFFLKVWYDPR
QLKTLWVQVDAMIVALSLVVGMIMSVRDNLVQKMIKSVEIAVVVDFLDFR
EPAQLAYLEDVVTGLAVALVTMRLWKVLQFSATFQLFTKTIAMAWDALLC
TFVITVIFIIAIGIATVTINGNYTSNFRDFPKGIVTVTCFAFGYTNLVYP
PDIFYGGEWLGILLYTIMGFVVKYMLINLIVSMMRDQMASVKADRDKKVR
QRITFWQFLRVEYAHFINYIVKVFHCQKGYQRKNRTVAQNIQRKLNSNEL
KRRKTKISSIYSETIYVMPIDKDLEQMKYRERIERTFTLAAILHTQMELM
ERLMFGDEEGNLPSLDQEDEQVPETEED*

MIP06652.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10757-PA 751 GF10757-PA 5..711 4..712 1980 51.7 Plus
Dana\GF21928-PA 770 GF21928-PA 4..701 3..696 1241 39 Plus
Dana\GF24319-PA 749 GF24319-PA 17..715 13..713 1080 34.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:28:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13405-PA 727 GG13405-PA 1..727 1..727 3386 86.9 Plus
Dere\GG12602-PA 749 GG12602-PA 27..716 26..708 1261 39.5 Plus
Dere\GG15821-PA 736 GG15821-PA 14..730 10..724 1142 34.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:28:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14403-PA 700 GH14403-PA 6..699 4..709 1336 41.2 Plus
Dgri\GH14404-PA 672 GH14404-PA 2..640 72..708 1227 38.9 Plus
Dgri\GH14405-PA 355 GH14405-PA 2..354 167..528 661 40.3 Plus
Dgri\GH23908-PA 279 GH23908-PA 3..278 243..528 563 41.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:28:39
Subject Length Description Subject Range Query Range Score Percent Strand
brv1-PA 728 CG9472-PA 1..728 1..728 3795 100 Plus
brv3-PC 750 CG13762-PC 4..728 3..727 1346 37.9 Plus
brv3-PB 719 CG13762-PB 4..658 3..652 1315 39.8 Plus
brv2-PA 736 CG16793-PA 14..730 10..724 1154 34.9 Plus
brv2-PB 714 CG16793-PB 14..708 10..724 1087 33.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13528-PA 725 GI13528-PA 4..701 3..709 1306 38.8 Plus
Dmoj\GI13527-PA 749 GI13527-PA 12..739 7..727 1201 35.2 Plus
Dmoj\GI23998-PA 717 GI23998-PA 1..705 1..703 1127 35.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20897-PA 742 GL20897-PA 3..736 6..728 1596 42.3 Plus
Dper\GL26193-PA 637 GL26193-PA 30..618 29..613 1005 33.9 Plus
Dper\GL15493-PA 494 GL15493-PA 3..487 240..724 932 37.9 Plus
Dper\GL20936-PA 698 GL20936-PA 292..594 421..720 657 42 Plus
Dper\GL20936-PA 698 GL20936-PA 3..307 4..305 622 41.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:28:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28227-PA 742 GA28227-PA 3..736 6..728 1596 42.7 Plus
Dpse\GA28635-PA 745 GA28635-PA 3..738 4..728 1477 40 Plus
Dpse\GA14155-PA 733 GA14155-PA 9..726 6..724 1249 36.5 Plus
Dpse\GA23663-PA 724 GA23663-PA 30..715 29..714 1079 32.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18537-PA 728 GM18537-PA 1..728 1..728 3506 93.7 Plus
Dsec\GM18868-PA 741 GM18868-PA 27..727 26..728 1283 38.7 Plus
Dsec\GM24341-PA 736 GM24341-PA 14..717 10..714 1125 36 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12280-PA 699 GD12280-PA 1..692 1..692 3396 94.4 Plus
Dsim\GD12415-PA 736 GD12415-PA 14..717 10..714 1107 35.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11886-PA 637 GJ11886-PA 1..620 94..708 1102 38.1 Plus
Dvir\GJ11887-PA 448 GJ11887-PA 1..441 1..434 734 35.4 Plus
Dvir\GJ11888-PA 272 GJ11888-PA 1..233 478..707 462 39.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16275-PA 723 GK16275-PA 3..710 2..709 1397 39.7 Plus
Dwil\GK19163-PA 741 GK19163-PA 5..634 4..631 1356 43 Plus
Dwil\GK18898-PA 737 GK18898-PA 5..710 4..715 1246 37 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22932-PA 726 GE22932-PA 1..726 1..728 3380 86.7 Plus
Dyak\GE22161-PA 735 GE22161-PA 14..729 10..724 1162 35.9 Plus
Dyak\GE16933-PA 628 GE16933-PA 1..616 120..723 1133 38.3 Plus
Dyak\GE22501-PA 323 GE22501-PA 70..323 475..728 1067 82.7 Plus
Dyak\GE22501-PA 323 GE22501-PA 1..84 1..84 408 90.5 Plus

MIP06652.hyp Sequence

Translation from 29 to 2215

> MIP06652.hyp
MAKKFSNIIFYLTLIIIAICVACIWMFSGFRHEYGKFNMILVAFLAVTLL
QILIFTPIKFTIMSLDAAFWPAHQAPETPDENANVDTFMDNLRLRLRTLR
SELMITERHRNERVNLKYRLITEELWLTGKLFLVYFFMALAFFDELLYFN
TEATELLFQCNHGDAFGLLSVGDVPDIYFFVVSSLVLAFTDGKNTSGGAP
WIHAEGTRLLGVVRLRQLRTESNRLGLSLPVFTERDFSESWTLPYERVPY
TDKYWPIYTPWLPSVSVARDNLLMGINHVGHMFNYPESKGYKVLLSDTRH
KSLKIIDYLMKKNWLDANTTALFMDFSLYNADANTFTVCTLWVEKFPYQY
PDGHTRIESHTFVEQLREFTKFGMLMVFVFVVTWLQFTKAFFLKVWYDPR
QLKTLWVQVDAMIVALSLVVGMIMSVRDNLVQKMIKSVEIAVVVDFLDFR
EPAQLAYLEDVVTGLAVALVTMRLWKVLQFSATFQLFTKTIAMAWDALLC
TFVITVIFIIAIGIATVTINGNYTSNFRDFPKGIVTVTCFAFGYTNLVYP
PDIFYGGEWLGILLYTIMGFVVKYMLINLIVSMMRDQMASVKADRDKKVR
QRITFWQFLRVEYAHFINYIVKVFHCQKGYQRKNRTVAQNIQRKLNSNEL
KRRKTKISSIYSETIYVMPIDKDLEQMKYRERIERTFTLAAILHTQMELM
ERLMFGDEEGNLPSLDQEDEQVPETEED*

MIP06652.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:31:01
Subject Length Description Subject Range Query Range Score Percent Strand
brv1-PA 728 CG9472-PA 1..728 1..728 3795 100 Plus
brv3-PC 750 CG13762-PC 4..728 3..727 1346 37.9 Plus
brv3-PB 719 CG13762-PB 4..658 3..652 1315 39.8 Plus
brv2-PA 736 CG16793-PA 14..730 10..724 1154 34.9 Plus
brv2-PB 714 CG16793-PB 14..708 10..724 1087 33.5 Plus