Clone MIP06826 Report

Search the DGRC for MIP06826

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:68
Well:26
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptMf-RF
Protein status:MIP06826.pep: gold
Sequenced Size:2028

Clone Sequence Records

MIP06826.complete Sequence

2028 bp assembled on 2009-04-06

GenBank Submission: BT081982.1

> MIP06826.complete
AGCTTTGCCACACAGATGCGATGAAAATCGCTCACGGATAGAGCAACCTA
CGCCGTAAAGGAATGCGCCGTGCTTTTGGTGCCGAAACGGAATGGCAAAA
TTCTGAAACGAGGAAAATTGCGAACGAGTTCAACGATTTTTTCGTGAACA
GAACAAAACAAATCGATCAAAATGTTCAAAAACCACTTGGAAATGATTGG
GCGCAATGAGAGCCCCAGCAAGAAGGCGAAATTCTGGCAGTCCTACATCA
GGTCCCTGAAGGGCTCCGAGGATATCCGTGCCCACGAGGCGCCCCGTGCC
TCTCGTCCCTACAGCTCCTACCTGGACTCGCCCTCCTACAGGAGCATCTA
TGACGAGCCCGCCACCGCCAATGAGCGCGTCCAGTCCTCTGGCTACAGAT
ATCTGCCAGTGAGCCGCGACACCTACGGCTACTCGCCCCGTGCCATCTAC
GATCATCACTACAGCCGAACAATTCCAGCTAACTACGACGCAGAGAAGGC
CTGGAATGATCATCTGAAGCGCATGCAGGAGATCGAGCGCAGGTACCCAT
CTCGCTATGGTCTCTACTTGAGGGACAAGCCACTCACGCCCAACTCGCTG
GTGCCCCTGGAGTACGAGCCAGAGGACAAGCTGCTGGCTGAGCTCAACAA
GGCTCGTCGCTCGGCCTCGCCGTTCCGCCCTGCCAGGACGACCCGTGCCG
GCAGCGAGCCGTACGTGCCACCGCCGAGCTACTGGAACCGCGAGGGCAGC
GTGCCACGCGGAGGACCCTCGGTCTTCGATCGTGCCACCAGCTTGGCCCC
GTTCACGCGGCCCAGCTTCCGTGCCAGCTCCCTGGAGCCGCTGGACGAAC
TCTTTGAACGACTCCCCATCTTTCACCCACGCAACCGCTTCAGGGATCTG
CTGAGCCCCAGCCCCAACTTGCCGATCTCCTCGATTGTGCGCGATCCCTT
CTGGTGGGACGTGGATGACCTGGTGCCCTTCCGCGCCACCTCGGTGCCCC
GTGCCTCGAGCCCCGTGGCCCGGGATTCGTACTTGTCGCCGGTGAAGAAC
CGCTACTTGTGGTCCAAGCACCCAGCTAGACCCTTGACACCTGAGGAAGA
GGATTTATTCTAAACAAATTATATAGATTCAAAATCACAAACAATCGTTT
AGCTCTAATAACAAAGCGACGCTATACAAATCATATAGCAGTTCTGTAAT
TTTTTTGTACTTAATTTTACATAAATTACACGTAACGAAACGTAAAAAAA
AAAAACAAATTGCTCACCGCTCAATTTTGTAAACGAACGAAACAACGAAC
TACACACCAACTAAATAACATCCTGAAGAACTAAAACAACGAATGCATCA
CACAAGGGGCCCCCAAAACAATGACAACCTGCTTTGGAGTAGATCAGTAG
CAAAAGGCTTTGCAAGTCTTAATATCCGTGAAAAACGTTTGAATTTTTTC
AAAACTGCAAGAACTCCCCTCGGAACGAGAAAACAACCATCACTTTCGTC
TGGGGTTCTCAAAATATTTGCCAAGAAGTGCGTAATTCCCGTAGAAAAAA
AAAAACAACCGTATAAAACTCAAACTATCTGTTTAATTTTTATTATTTTC
CGATTTCTTAAGAACCTTATCGTAAATGTTAAGTGCAAGAATATGAAAAA
AATCGATTTACATTTATTATAATAAAACAATAAAATCAACTTATGAGTTC
CCATTTGCAACATCAACATCGCACACTCAATGGGCTTCATAAATTGTTCC
TTTTTTGTATATCTTAGATGCTATATATAAAATATTTATACAACTATTTG
TATTTGTAAAAAGTATCGTCTCTCATGCGGAGCTCGATGACATTTAGAAA
AATGTATAAGGCATATATGTATATCTGCCACAACACATCCAACATTCGGC
CTTTCCATATATACATACATATGCTGAACATTTTCGATTTGTAATAAAAC
ATTAAAAAAAAAAACAACAACAAAATTATGAATAATAATAAATAAAAAAC
TTCTAAAACCCAAAAAAAAAAAAAAAAA

MIP06826.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
Mf-RF 2020 Mf-RF 10..2020 1..2011 9980 99.9 Plus
Mf.j 2427 Mf.j 1273..2426 860..2013 5695 99.8 Plus
Mf-RB 2336 Mf-RB 1184..2336 860..2012 5690 99.8 Plus
Mf-RB 2336 Mf-RB 289..1028 121..860 3700 100 Plus
Mf.j 2427 Mf.j 301..1039 121..859 3695 100 Plus
Mf.j 2427 Mf.j 96..215 1..120 600 100 Plus
Mf-RB 2336 Mf-RB 84..203 1..120 600 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:03:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10995253..10996004 2011..1262 3570 99.2 Minus
chr3R 27901430 chr3R 10997229..10997459 1090..860 1155 100 Minus
chr3R 27901430 chr3R 11002908..11003118 472..262 1055 100 Minus
chr3R 27901430 chr3R 10998765..10998973 860..652 1045 100 Minus
chr3R 27901430 chr3R 10996572..10996739 1254..1087 825 99.4 Minus
chr3R 27901430 chr3R 11003666..11003809 263..120 705 99.3 Minus
chr3R 27901430 chr3R 11004921..11005040 120..1 600 100 Minus
chr3R 27901430 chr3R 11000813..11000924 652..541 560 100 Minus
chr3R 27901430 chr3R 11000991..11001066 544..469 365 98.7 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:03:04
Subject Length Description Subject Range Query Range Score Percent Strand
Mf-RJ 942 CG6803-PJ 1..942 172..1113 4710 100 Plus
Mf-RF 942 CG6803-PF 1..942 172..1113 4710 100 Plus
Mf-RD 939 CG6803-PD 1..921 172..1092 4605 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:07:36 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:03:03
Subject Length Description Subject Range Query Range Score Percent Strand
Mf-RF 2020 CG6803-RF 10..2020 1..2011 9960 99.9 Plus
Mf-RJ 1954 CG6803-RJ 64..1954 121..2011 9360 99.9 Plus
Mf-RB 2110 CG6803-RB 959..2110 860..2011 5665 99.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:03:06
Subject Length Description Subject Range Query Range Score Percent Strand
Mf-PJ 313 CG6803-PJ 1..313 172..1110 1530 100 Plus
Mf-PF 313 CG6803-PF 1..313 172..1110 1530 100 Plus
Mf-PD 312 CG6803-PD 1..312 172..1107 1500 98.7 Plus
Mf-PO 310 CG6803-PO 1..310 172..1107 1472 97.8 Plus
Mf-PB 365 CG6803-PB 1..365 172..1110 1467 85.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:03:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15170623..15171375 2013..1262 3715 99.9 Minus
3R 32079331 3R 15172600..15172830 1090..860 1155 100 Minus
3R 32079331 3R 15178280..15178490 472..262 1055 100 Minus
3R 32079331 3R 15174136..15174344 860..652 1045 100 Minus
3R 32079331 3R 15171943..15172110 1254..1087 825 99.4 Minus
3R 32079331 3R 15179038..15179181 263..120 720 100 Minus
3R 32079331 3R 15180293..15180412 120..1 600 100 Minus
3R 32079331 3R 15176184..15176295 652..541 560 100 Minus
3R 32079331 3R 15176362..15176437 544..469 365 98.7 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14911454..14912206 2013..1262 3725 99.8 Minus
3R 31820162 3R 14913431..14913661 1090..860 1155 100 Minus
3R 31820162 3R 14919111..14919321 472..262 1055 100 Minus
3R 31820162 3R 14914967..14915175 860..652 1045 100 Minus
3R 31820162 3R 14912774..14912941 1254..1087 825 99.4 Minus
3R 31820162 3R 14919869..14920012 263..120 720 100 Minus
3R 31820162 3R 14921124..14921243 120..1 600 100 Minus
3R 31820162 3R 14917015..14917126 652..541 560 100 Minus
3R 31820162 3R 14917193..14917268 544..469 365 98.6 Minus
Blast to na_te.dros performed 2014-11-27 07:03:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\INE-1 1467 Dbuz\INE-1 ISBU1 1467bp 534..615 1989..1907 124 62.7 Minus

MIP06826.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:37:13 Download gff for MIP06826.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11004921..11005040 1..120 100   Minus
chr3R 11003667..11003808 121..262 99 <- Minus
chr3R 11002908..11003117 263..472 100 <- Minus
chr3R 11000993..11001062 473..542 100 <- Minus
chr3R 11000813..11000922 543..652 100 <- Minus
chr3R 10998766..10998972 653..859 100 <- Minus
chr3R 10997229..10997459 860..1090 100 <- Minus
chr3R 10996565..10996735 1091..1262 99 <- Minus
chr3R 10995323..10996003 1263..1940 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:08:38 Download gff for MIP06826.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RD 1..921 172..1092 100 == Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:43:37 Download gff for MIP06826.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RJ 1..942 172..1113 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:42:07 Download gff for MIP06826.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RF 1..942 172..1113 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:37:13 Download gff for MIP06826.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RF 1..942 172..1113 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-04-06 10:00:29 Download gff for MIP06826.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RB 59..802 115..859 99 -> Plus
Mf-RB 958..2110 860..2011 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:43:37 Download gff for MIP06826.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RF 10..2020 1..2011 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:42:07 Download gff for MIP06826.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RF 10..2020 1..2011 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:37:13 Download gff for MIP06826.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RF 10..2020 1..2011 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:37:13 Download gff for MIP06826.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15180293..15180412 1..120 100   Minus
3R 15179039..15179180 121..262 100 <- Minus
3R 15178280..15178489 263..472 100 <- Minus
3R 15176364..15176433 473..542 100 <- Minus
3R 15176184..15176293 543..652 100 <- Minus
3R 15174137..15174343 653..859 100 <- Minus
3R 15172600..15172830 860..1090 100 <- Minus
3R 15171936..15172106 1091..1262 99 <- Minus
3R 15170625..15171374 1263..2011 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:42:07 Download gff for MIP06826.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11006015..11006134 1..120 100   Minus
arm_3R 11004761..11004902 121..262 100 <- Minus
arm_3R 11004002..11004211 263..472 100 <- Minus
arm_3R 11002086..11002155 473..542 100 <- Minus
arm_3R 11001906..11002015 543..652 100 <- Minus
arm_3R 10999859..11000065 653..859 100 <- Minus
arm_3R 10998322..10998552 860..1090 100 <- Minus
arm_3R 10997658..10997828 1091..1262 99 <- Minus
arm_3R 10996347..10997096 1263..2011 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:18:38 Download gff for MIP06826.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14921124..14921243 1..120 100   Minus
3R 14919870..14920011 121..262 100 <- Minus
3R 14919111..14919320 263..472 100 <- Minus
3R 14917195..14917264 473..542 100 <- Minus
3R 14917015..14917124 543..652 100 <- Minus
3R 14914968..14915174 653..859 100 <- Minus
3R 14913431..14913661 860..1090 100 <- Minus
3R 14912767..14912937 1091..1262 99 <- Minus
3R 14911456..14912205 1263..2011 99 <- Minus

MIP06826.pep Sequence

Translation from 171 to 1112

> MIP06826.pep
MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSY
LDSPSYRSIYDEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRT
IPANYDAEKAWNDHLKRMQEIERRYPSRYGLYLRDKPLTPNSLVPLEYEP
EDKLLAELNKARRSASPFRPARTTRAGSEPYVPPPSYWNREGSVPRGGPS
VFDRATSLAPFTRPSFRASSLEPLDELFERLPIFHPRNRFRDLLSPSPNL
PISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKH
PARPLTPEEEDLF*

MIP06826.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17159-PA 370 GF17159-PA 1..370 1..313 1373 77.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:05:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20880-PA 365 GG20880-PA 1..365 1..313 1539 85.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:05:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14549-PA 367 GH14549-PA 1..367 1..313 1354 77.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
Mf-PJ 313 CG6803-PJ 1..313 1..313 1678 100 Plus
Mf-PF 313 CG6803-PF 1..313 1..313 1678 100 Plus
Mf-PD 312 CG6803-PD 1..312 1..312 1648 98.7 Plus
Mf-PO 310 CG6803-PO 1..310 1..312 1620 97.8 Plus
Mf-PB 365 CG6803-PB 1..365 1..313 1615 85.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:05:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23663-PA 367 GI23663-PA 1..367 1..313 1491 82.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:05:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21688-PA 367 GL21688-PA 1..367 1..313 1475 81.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:05:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19873-PA 313 GA19873-PA 1..313 1..313 1552 95.8 Plus
Dpse\GA19873-PC 312 GA19873-PC 1..312 1..312 1533 95.5 Plus
Dpse\GA19873-PB 367 GA19873-PB 1..367 1..313 1474 81.5 Plus
Dpse\GA19873-PD 168 GA19873-PD 1..162 1..162 824 96.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:05:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25804-PA 367 GM25804-PA 1..367 1..312 1492 83.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:05:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20380-PA 236 GD20380-PA 1..229 1..229 1177 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:05:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23223-PA 363 GJ23223-PA 1..363 1..313 1486 82.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:05:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13979-PA 368 GK13979-PA 1..368 1..313 1455 80.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:05:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26409-PA 313 GE26409-PA 1..313 1..313 1600 99 Plus

MIP06826.hyp Sequence

Translation from 171 to 1112

> MIP06826.hyp
MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSY
LDSPSYRSIYDEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRT
IPANYDAEKAWNDHLKRMQEIERRYPSRYGLYLRDKPLTPNSLVPLEYEP
EDKLLAELNKARRSASPFRPARTTRAGSEPYVPPPSYWNREGSVPRGGPS
VFDRATSLAPFTRPSFRASSLEPLDELFERLPIFHPRNRFRDLLSPSPNL
PISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWSKH
PARPLTPEEEDLF*

MIP06826.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
Mf-PJ 313 CG6803-PJ 1..313 1..313 1678 100 Plus
Mf-PF 313 CG6803-PF 1..313 1..313 1678 100 Plus
Mf-PD 312 CG6803-PD 1..312 1..312 1648 98.7 Plus
Mf-PO 310 CG6803-PO 1..310 1..312 1620 97.8 Plus
Mf-PB 365 CG6803-PB 1..365 1..313 1615 85.8 Plus