Clone MIP06948 Report

Search the DGRC for MIP06948

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:69
Well:48
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42876-RA
Protein status:MIP06948.pep: gold
Sequenced Size:1122

Clone Sequence Records

MIP06948.complete Sequence

1122 bp assembled on 2009-03-10

GenBank Submission: BT072854.1

> MIP06948.complete
CTCGGGTTACCATGTCGGTGCAATGGAAAATTGTCATAATGAGCTTCTTT
CTGTTCAGTACCGCGCACGCTGGAGGATATTGTGGACCCAACAAGATATA
TGCGTGTGTGCCTACGCTATTTTGTAAAGATGGTCGCAGCACGCAAAGAA
ATCCCGCTGCTCACTTCAACAGGCAGTGCTTTTCGTTTGAATCTTGCTGT
GACGTTAATAGGGTAATTTATGGAATGCGGTACACTGGAGGAGATTTCGA
GCCAGGTCCATACGAACAAATCAGCGAGCCATTCAACAATGCTAGTGGAA
AAACTTCTGGCACAAACAGTCAACAGTCAACTGGTAATACGGGTGGCACT
AGTCCGACCTTGAAAAAAAAGGGCGGAGTGTCATCTATAACGAACATTCA
AAATACTAATAATGGCGGAGGCAAAAATTTTACAACAAATAGTCAAATGC
CGAGTTATACGATGAAAAGTCAGCCATCCAATAACGCAGGTGGAAAAACC
ACTACTGCAAACAATCAGGCACCCAGTGACTCAGATGGAAAAACTTTTAC
ACACAGTACAAATTTACATGCTCATAGTTATCTTAACAATAATTCCGGAA
AAACTAACTTAGGAAACCCATCTACGGCTAATACTAAAAATACAAAAAGT
CCAAATTATCATCATTATCAAAATCATAATTACAATCCCAGTGGCAATTT
GGGCAGGGATGTTGGAGTTCATAGACTATCTTCAAACATTTAAGTAATAT
CACAATTCATAAATTCAAGATAAGCTAAAGAGCGATTCGAAACTTTTAAT
AAATAAATACGTAAATATACTACAGTAGACGTAGTACGCTTAGAAAAACT
GTTGAAACCTTTACACGATTAAAGAAATGAAAAGTACGTTCTGATAACCG
TCTGGAAAACGGGAAAAGGCGATGGAGAGAAAGGTCAGCTAGACCGCTGC
AGCTGTCACCATTGACAGGAAGTCGAAAGTTAGCGTCCCCCAAAAGCGGA
ACTCAAACTGACAGCAACAAACACACTCACCCGCCAGCCTCAAGGGCAGC
CGAAAAGAAAATCAAGGCATGACAGAAATAAAGGACAAATATCTATAGGA
AAATAAAAAAAAAAAAAAAAAA

MIP06948.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:35
Subject Length Description Subject Range Query Range Score Percent Strand
MB8.chr2L.pasa.11.a 1178 MB8.chr2L.pasa.11.a 1..1109 1..1109 5545 100 Plus
MB8.chr2L.pasa.11.b 1513 MB8.chr2L.pasa.11.b 1..1109 1..1109 5545 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 15809699..15810591 1104..212 4465 100 Minus
chr2L 23010047 chr2L 15810647..15810860 214..1 1070 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG42876-RA 732 CG42876-PA 1..732 12..743 3660 100 Plus
CG42876-RB 732 CG42876-PB 1..732 12..743 3660 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:00 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG42876-RA 1104 CG42876-RA 1..1104 1..1104 5520 100 Plus
CG42876-RB 1513 CG42876-RB 1..1104 1..1104 5520 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:38:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42876-PA 243 CG42876-PA 1..243 12..740 1053 100 Plus
CG42876-PB 243 CG42876-PB 1..243 12..740 1053 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15810975..15811872 1109..212 4490 100 Minus
2L 23513712 2L 15811928..15812141 214..1 1070 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15810975..15811872 1109..212 4490 100 Minus
2L 23513712 2L 15811928..15812141 214..1 1070 100 Minus
Blast to na_te.dros performed 2014-11-27 02:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
looper1 1881 looper1 LOOPER1_DM 1881bp 1054..1140 542..626 124 65.2 Plus

MIP06948.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:21:23 Download gff for MIP06948.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 15810649..15810860 1..212 100   Minus
chr2L 15809699..15810590 213..1104 100 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:55 Download gff for MIP06948.complete
Subject Subject Range Query Range Percent Splice Strand
CG42876-RA 1..732 12..743 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:01:26 Download gff for MIP06948.complete
Subject Subject Range Query Range Percent Splice Strand
CG42876-RB 1..732 12..743 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:21:23 Download gff for MIP06948.complete
Subject Subject Range Query Range Percent Splice Strand
CG42876-RB 1..732 12..743 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:54 Download gff for MIP06948.complete
Subject Subject Range Query Range Percent Splice Strand
CG42876-RA 1..1104 1..1104 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:01:26 Download gff for MIP06948.complete
Subject Subject Range Query Range Percent Splice Strand
CG42876-RB 1..1104 1..1104 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:21:23 Download gff for MIP06948.complete
Subject Subject Range Query Range Percent Splice Strand
CG42876-RB 1..1104 1..1104 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:21:23 Download gff for MIP06948.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15811930..15812141 1..212 100   Minus
2L 15810980..15811871 213..1104 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:01:26 Download gff for MIP06948.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15811930..15812141 1..212 100   Minus
arm_2L 15810980..15811871 213..1104 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:14:06 Download gff for MIP06948.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15811930..15812141 1..212 100   Minus
2L 15810980..15811871 213..1104 100 <- Minus

MIP06948.pep Sequence

Translation from 2 to 742

> MIP06948.pep
RVTMSVQWKIVIMSFFLFSTAHAGGYCGPNKIYACVPTLFCKDGRSTQRN
PAAHFNRQCFSFESCCDVNRVIYGMRYTGGDFEPGPYEQISEPFNNASGK
TSGTNSQQSTGNTGGTSPTLKKKGGVSSITNIQNTNNGGGKNFTTNSQMP
SYTMKSQPSNNAGGKTTTANNQAPSDSDGKTFTHSTNLHAHSYLNNNSGK
TNLGNPSTANTKNTKSPNYHHYQNHNYNPSGNLGRDVGVHRLSSNI*

MIP06948.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 17:35:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG42876-PA 243 CG42876-PA 1..243 4..246 1330 100 Plus
CG42876-PB 243 CG42876-PB 1..243 4..246 1330 100 Plus

MIP06948.hyp Sequence

Translation from 2 to 742

> MIP06948.hyp
RVTMSVQWKIVIMSFFLFSTAHAGGYCGPNKIYACVPTLFCKDGRSTQRN
PAAHFNRQCFSFESCCDVNRVIYGMRYTGGDFEPGPYEQISEPFNNASGK
TSGTNSQQSTGNTGGTSPTLKKKGGVSSITNIQNTNNGGGKNFTTNSQMP
SYTMKSQPSNNAGGKTTTANNQAPSDSDGKTFTHSTNLHAHSYLNNNSGK
TNLGNPSTANTKNTKSPNYHHYQNHNYNPSGNLGRDVGVHRLSSNI*

MIP06948.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42876-PA 243 CG42876-PA 1..243 4..246 1330 100 Plus
CG42876-PB 243 CG42876-PB 1..243 4..246 1330 100 Plus