Clone MIP06967 Report

Search the DGRC for MIP06967

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:69
Well:67
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptGlycogenin-RC
Protein status:MIP06967.pep: wuzgold
Sequenced Size:1617

Clone Sequence Records

MIP06967.complete Sequence

1617 bp assembled on 2009-03-10

GenBank Submission: BT072855.1

> MIP06967.complete
AGATTCTCGTCATCGCTCGTGGAAGGCACATCGCAAACGCCGCTCTCGTT
CTCGAATTTATTGTGAAAGCTCAGCCGCCCACCGCCCGCCGGAAAAGTCT
CGCGAGTGTCCCGAAAAAATCGAGTTAACCCCCCAAAAAAATCTATCATA
TAAAATCCTAACAAAATGAGCAAATTCGCTTGGGTGACGCTGACGACAAA
TGACACGTACTCACTGGGTGCCTTGGTCTTGGCCCACTCACTGAAAAGGG
CCAAGACCGCCCACCAGCTGGCCGTTCTGGTCACGCCCAATGTCTCGCAG
GCGATGCGCGACCGACTGAAGGAGGTCTACAATGTGGTGCAGGAGGTCAA
TGTGCTCGACTCACAGGATGCCGCCAATCTGGCGCTCCTCTCGCGACCCG
AACTAGGCGTGACCTTCACAAAACTCCACTGCTGGCGCCTCGTTCAGTTT
GAGAAGTGCGTCTTCCTGGATGCGGACACACTGGTCTTGCAAAACTGCGA
TGAGCTCTTCGAGCGCGAGGAACTGTCGGCTGCTCCGGATGTCAGCTGGC
CGGATTGCTTCAATTCCGGCGTGTTTGTGTTCAAACCTAGCGTGGACACC
TTTGCCCAGATCACAGAGTTTGCCGTGAAGAATGGCAGCTTCGATGGCGG
TGACCAGGGTCTGCTGAATCAGTTCTTTGCCGACTGGTCGACGGCGGACA
TTAAGAAGCATTTGCCATTTGTGTACAATGTGACGGCTTATGCCTCGTAC
TGTTATCTGCCCGCCTTCAAACAGTTCAGAGATAAGATTAAGATTTTGCA
TTTTGCCGGCAAGCTGAAGCCCTGGCTGATTCAGTTCAACTCGGAAACAA
AGGTGGCCAGCGTTTCGTCGGAGTATGCTCATGCCCAGGATTTGATTCAG
CTGTGGTGGAACATCTTTTGCGAAAATGTCATCCAGTCCCTGTCCACCGA
AATGATAATGATAACGATAGTGATCCCGCTAACCCACTAAGCTCAGCTCG
ATTGCTAAACGAAGCCGCCAGCATACTGCTGCATCCGCCCGAGAAATCAC
CAACTTCAAAGGCGATGAAAGCGAATGGGGCGACTGGGAATGGCTCCCAT
CTCGACCAGTCGCATCCCACCAACTCCCCAGCAACTAACAAACAGCCTGC
GAATGCTTCAGCTTCCCCCAATGCCTCCTTGAAACAAAATCCACAGAAGC
GACAGGAGAAACCGCAGCCCCAAGCGGAACCGGAACTGGAACCGAGACCA
CAACCACAACCGCAGCCAACAGAGCAGCACATCAGGATGCAGCCAGGCGG
CGGAAATGGCAGCGTCTCCAAGAGCGGCAAACAGAGGTCCGCACGCAAGT
TCAAATAGCAATTACTGAAGCTGCTGATGCACTACAGCTGCCTGCCACAC
CTGGCGTGCCGCTGCAAGTCGCAGTATCGGCGGCTGGAACCCAATCTGGA
TACCGAACCCCAACCCGTCCACGTCTAAACCCGACGATTGATAGACAGAT
CCGAGGAAGTACAAAGCGTATGCCACGATAAATGCTGTACAAATTGCTTG
CTAAGTGGCTCTTAGACGAAAGTAAAGTAATCAAATCGAAACGAAAAAAA
AAAAAAAAAAAAAAAAA

MIP06967.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:36
Subject Length Description Subject Range Query Range Score Percent Strand
Glycogenin-RC 1606 Glycogenin-RC 14..1606 1..1593 7965 100 Plus
Glycogenin.h 3782 Glycogenin.h 56..1009 1..954 4770 100 Plus
Glycogenin.i 1979 Glycogenin.i 22..975 1..954 4770 100 Plus
Glycogenin.h 3782 Glycogenin.h 2722..3363 954..1595 3210 100 Plus
Glycogenin.i 1979 Glycogenin.i 1388..1979 954..1545 2960 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 14:48:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 17096596..17097235 954..1593 3140 99.4 Plus
chr2R 21145070 chr2R 17091015..17091327 173..485 1505 98.7 Plus
chr2R 21145070 chr2R 17091416..17091708 483..775 1420 99 Plus
chr2R 21145070 chr2R 17086908..17087079 1..172 860 100 Plus
chr2R 21145070 chr2R 17091768..17091952 774..958 835 96.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:48:24
Subject Length Description Subject Range Query Range Score Percent Strand
Glycogenin-RH 1005 CG44244-PH 1..789 166..954 3945 100 Plus
Glycogenin-RG 1071 CG44244-PG 1..789 166..954 3945 100 Plus
Glycogenin-RD 1638 CG44244-PD 1..789 166..954 3945 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:02 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:48:23
Subject Length Description Subject Range Query Range Score Percent Strand
Glycogenin-RH 2010 CG44244-RH 5..958 1..954 4770 100 Plus
Glycogenin-RG 2447 CG44244-RG 5..958 1..954 4770 100 Plus
Glycogenin-RD 3014 CG44244-RD 5..958 1..954 4770 100 Plus
Glycogenin-RH 2010 CG44244-RH 1371..2010 954..1593 3200 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 14:48:26
Subject Length Description Subject Range Query Range Score Percent Strand
Glycogenin-PD 545 CG44244-PD 1..270 166..975 1383 97.8 Plus
Glycogenin-PB 333 CG44244-PB 1..263 166..954 1380 100 Plus
Glycogenin-PH 334 CG44244-PH 1..263 166..954 1380 100 Plus
Glycogenin-PG 356 CG44244-PG 1..263 166..954 1380 100 Plus
Glycogenin-PE 699 CG44244-PE 1..263 166..954 1380 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 14:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21210182..21210823 954..1595 3210 100 Plus
2R 25286936 2R 21204613..21204925 173..485 1565 100 Plus
2R 25286936 2R 21205009..21205301 483..775 1465 100 Plus
2R 25286936 2R 21205361..21205545 774..958 910 99.5 Plus
2R 25286936 2R 21200487..21200658 1..172 860 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:28
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 21211381..21212022 954..1595 3210 100 Plus
2R 25260384 2R 21205812..21206124 173..485 1565 100 Plus
2R 25260384 2R 21206208..21206500 483..775 1465 100 Plus
2R 25260384 2R 21206560..21206744 774..958 910 99.4 Plus
2R 25260384 2R 21201686..21201857 1..172 860 100 Plus
Blast to na_te.dros performed on 2014-11-27 14:48:21 has no hits.

MIP06967.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:00:10 Download gff for MIP06967.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 17096597..17097235 955..1593 99   Plus
chr2R 17091768..17091948 774..954 97 -> Plus
chr2R 17091417..17091706 484..773 98 -> Plus
chr2R 17091015..17091325 173..483 98 -> Plus
chr2R 17086908..17087079 1..172 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:30:12 Download gff for MIP06967.complete
Subject Subject Range Query Range Percent Splice Strand
Glycogenin-RB 1..789 166..954 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:56 Download gff for MIP06967.complete
Subject Subject Range Query Range Percent Splice Strand
Glycogenin-RC 1..825 166..990 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:06:15 Download gff for MIP06967.complete
Subject Subject Range Query Range Percent Splice Strand
Glycogenin-RD 1..789 166..954 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:00:10 Download gff for MIP06967.complete
Subject Subject Range Query Range Percent Splice Strand
Glycogenin-RD 1..789 166..954 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:30:11 Download gff for MIP06967.complete
Subject Subject Range Query Range Percent Splice Strand
Glycogenin-RB 1..954 1..954 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:56 Download gff for MIP06967.complete
Subject Subject Range Query Range Percent Splice Strand
Glycogenin-RC 14..1606 1..1593 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:06:15 Download gff for MIP06967.complete
Subject Subject Range Query Range Percent Splice Strand
Glycogenin-RD 5..958 1..954 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:00:10 Download gff for MIP06967.complete
Subject Subject Range Query Range Percent Splice Strand
Glycogenin-RD 5..958 1..954 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:00:10 Download gff for MIP06967.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21210183..21210821 955..1593 100   Plus
2R 21205361..21205541 774..954 100 -> Plus
2R 21205010..21205299 484..773 100 -> Plus
2R 21204613..21204923 173..483 100 -> Plus
2R 21200487..21200658 1..172 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:06:15 Download gff for MIP06967.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17097688..17098326 955..1593 100   Plus
arm_2R 17092866..17093046 774..954 100 -> Plus
arm_2R 17092515..17092804 484..773 100 -> Plus
arm_2R 17092118..17092428 173..483 100 -> Plus
arm_2R 17087992..17088163 1..172 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:14:07 Download gff for MIP06967.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21211382..21212020 955..1593 100   Plus
2R 21206560..21206740 774..954 100 -> Plus
2R 21206209..21206498 484..773 100 -> Plus
2R 21205812..21206122 173..483 100 -> Plus
2R 21201686..21201857 1..172 100 -> Plus

MIP06967.pep Sequence

Translation from 165 to 989

> MIP06967.pep
MSKFAWVTLTTNDTYSLGALVLAHSLKRAKTAHQLAVLVTPNVSQAMRDR
LKEVYNVVQEVNVLDSQDAANLALLSRPELGVTFTKLHCWRLVQFEKCVF
LDADTLVLQNCDELFEREELSAAPDVSWPDCFNSGVFVFKPSVDTFAQIT
EFAVKNGSFDGGDQGLLNQFFADWSTADIKKHLPFVYNVTAYASYCYLPA
FKQFRDKIKILHFAGKLKPWLIQFNSETKVASVSSEYAHAQDLIQLWWNI
FCENVIQSLSTEMIMITIVIPLTH*

MIP06967.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 17:36:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12803-PA 331 GF12803-PA 1..263 1..263 1354 94.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 17:36:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22100-PA 558 GG22100-PA 1..270 1..270 1415 97.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 17:36:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21859-PA 200 GH21859-PA 1..108 1..108 516 91.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 17:36:45
Subject Length Description Subject Range Query Range Score Percent Strand
Glycogenin-PD 545 CG44244-PD 1..270 1..270 1383 97.8 Plus
Glycogenin-PB 333 CG44244-PB 1..263 1..263 1380 100 Plus
Glycogenin-PH 334 CG44244-PH 1..263 1..263 1380 100 Plus
Glycogenin-PG 356 CG44244-PG 1..263 1..263 1380 100 Plus
Glycogenin-PE 699 CG44244-PE 1..263 1..263 1380 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 17:36:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20361-PA 332 GI20361-PA 1..263 1..263 1279 89 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 17:36:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11328-PA 299 GL11328-PA 1..264 1..264 1342 92.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 17:36:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21819-PA 334 GA21819-PA 1..263 1..263 1337 93.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 17:36:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15817-PA 333 GM15817-PA 1..263 1..263 1399 99.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 17:36:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11576-PA 476 GD11576-PA 1..106 1..106 553 100 Plus
Dsim\GD11576-PA 476 GD11576-PA 107..207 170..270 523 94.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 17:36:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22086-PA 286 GJ22086-PA 1..263 1..263 1280 90.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 17:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15794-PA 334 GK15794-PA 1..263 1..263 1318 91.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 17:36:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12180-PA 689 GE12180-PA 1..270 1..270 1414 97 Plus

MIP06967.hyp Sequence

Translation from 165 to 989

> MIP06967.hyp
MSKFAWVTLTTNDTYSLGALVLAHSLKRAKTAHQLAVLVTPNVSQAMRDR
LKEVYNVVQEVNVLDSQDAANLALLSRPELGVTFTKLHCWRLVQFEKCVF
LDADTLVLQNCDELFEREELSAAPDVSWPDCFNSGVFVFKPSVDTFAQIT
EFAVKNGSFDGGDQGLLNQFFADWSTADIKKHLPFVYNVTAYASYCYLPA
FKQFRDKIKILHFAGKLKPWLIQFNSETKVASVSSEYAHAQDLIQLWWNI
FCENVIQSLSTEMIMITIVIPLTH*

MIP06967.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
Glycogenin-PD 545 CG44244-PD 1..270 1..270 1383 97.8 Plus
Glycogenin-PB 333 CG44244-PB 1..263 1..263 1380 100 Plus
Glycogenin-PH 334 CG44244-PH 1..263 1..263 1380 100 Plus
Glycogenin-PG 356 CG44244-PG 1..263 1..263 1380 100 Plus
Glycogenin-PE 699 CG44244-PE 1..263 1..263 1380 100 Plus