Clone MIP06984 Report

Search the DGRC for MIP06984

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:69
Well:84
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG32428-RC
Protein status:MIP06984.pep: gold
Sequenced Size:1225

Clone Sequence Records

MIP06984.complete Sequence

1225 bp assembled on 2009-03-10

GenBank Submission: BT072856.1

> MIP06984.complete
AAAGGCGCACGCGGCAAAATGTAAAACTTGCTTATTGGTTTATTTTTAAC
AGTTGCCGTCACCGCATTTACAGTCGCATTTCGGCCGAATGCTCGCGCGC
CCCGCTTGCGTGTGTTAATTGAATTATTTCATCCATTTTAGCAACTGCTG
CGTATTTTCGGCGCTTATTAAGCCGACAGAGCCATCAAAATCCATACTGC
ATACAAATACGATTTCAATTAGGGGAAAAATACGCGCCTGCAGTTCGCCG
CACGATTTCGTACAGTACAGTACGGACGCAGAGGAGCGTTTTTTCCGAAT
TTACTGTACTTGCTTTTCGGTTTTTTTGGGGAAATTCCACTGCAGCTGGC
GCGCGATGGTTTTGACGAACTTCGAGTGCTGGGCACATGGTGATCCGTCG
TCGTCGGCGGCCGCCACTTTCGAAACTGGAGCGCTGCGTCCTTCGATGGA
TCCGTTCAATCCACGCGCCGTCACCTTCATGACCGACGCCAACAACAACA
ACAACAACAATGATGGCAATAACCTCGCGGCACAACCGATGCCGGTCGTC
CTGCCTCCGGAAGTCCTGCGCTGCAAGAAGCGCCTGAATCCCGGTCACAA
TCCTGTCGGGGATTTGGACACGGACCAACCGGTGTACACCAAGAGATGTC
GCTACGACGAGTCTGACTTGGCCGCCCAGTACTGCAATGATTTCTTTTCC
TTGCCTGCCACACAAATAATTGGAACGCAGGCCTCTTTGATGGATTACGA
GATGCAGGCCACCGGCGGCATGATGATGATGGAATCGGAGACGAGTTTTC
CAGCGCAGCAGCAGCAACATCAAGAGCAACAGCAACATCCACAGCAGCCA
CATCAATATCAGCGCATTCATCAGCATTATCAAGAATCCGCAGAGCAACG
AGTGCCGTCCCCGCAGCAAAAGTCAAGAAAATCTAATAATTCTATTGGGA
AAATCAAATTAAAGTCCATAGGCAGCGAAGCCGAAGCGGACTTGTATATA
GCCACACACGGCGGCAGTCTGCACCACTTTTGTGGGCTCGGCGGATCGGA
GCTAGAGGAGTCTGATATATGATAAAGTAACTCCGAGCAAGAATTGTACA
TCCTAGCCTAAGTTGTAATATAAGCTGTCGCAAACTAAAGGTGCTTACCA
ATAGTATTTGAGTTCGAATAAACCAAAAGCTATCGTGCGAAACTCAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAA

MIP06984.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG32428.a 1495 CG32428.a 167..1362 1..1196 5980 100 Plus
CG32428.b 1912 CG32428.b 167..1050 1..884 4420 100 Plus
CG32428-RA 1362 CG32428-RA 167..1050 1..884 4420 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:54:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 20461653..20462341 689..1 3445 100 Minus
chr3L 24539361 chr3L 20458683..20458995 1195..883 1565 100 Minus
chr3L 24539361 chr3L 20459965..20460160 884..689 980 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:54:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG32428-RC 717 CG32428-PC 1..717 356..1072 3585 100 Plus
CG32428-RB 588 CG32428-PB 1..529 356..884 2645 100 Plus
CG32428-RA 588 CG32428-PA 1..529 356..884 2645 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:05 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:54:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG32428-RC 1238 CG32428-RC 44..1238 1..1195 5975 100 Plus
CG32428-RA 1213 CG32428-RA 44..927 1..884 4420 100 Plus
CG32428-RB 1804 CG32428-RB 126..873 137..884 3740 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG32428-PC 238 CG32428-PC 1..238 356..1069 1016 100 Plus
CG32428-PB 195 CG32428-PB 1..150 356..805 732 100 Plus
CG32428-PA 195 CG32428-PA 1..150 356..805 732 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:54:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20472641..20473329 689..1 3445 100 Minus
3L 28110227 3L 20469673..20469986 1196..883 1570 100 Minus
3L 28110227 3L 20470954..20471149 884..689 980 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 20465741..20466429 689..1 3445 100 Minus
3L 28103327 3L 20462773..20463086 1196..883 1570 100 Minus
3L 28103327 3L 20464054..20464249 884..689 980 100 Minus
Blast to na_te.dros performed on 2014-11-26 21:54:33 has no hits.

MIP06984.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:43:04 Download gff for MIP06984.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 20461653..20462341 1..689 96   Minus
chr3L 20460049..20460159 690..800 100 <- Minus
chr3L 20459965..20459985 864..884 100 == Minus
chr3L 20458683..20458993 885..1195 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:52:24 Download gff for MIP06984.complete
Subject Subject Range Query Range Percent Splice Strand
CG32428-RB 1..532 356..888 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:57 Download gff for MIP06984.complete
Subject Subject Range Query Range Percent Splice Strand
CG32428-RC 1..717 356..1072 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:56:54 Download gff for MIP06984.complete
Subject Subject Range Query Range Percent Splice Strand
CG32428-RC 1..717 356..1072 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:43:04 Download gff for MIP06984.complete
Subject Subject Range Query Range Percent Splice Strand
CG32428-RC 1..717 356..1072 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-10 15:30:35 Download gff for MIP06984.complete
Subject Subject Range Query Range Percent Splice Strand
CG32428-RA 20..906 1..888 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:57 Download gff for MIP06984.complete
Subject Subject Range Query Range Percent Splice Strand
CG32428-RC 1..1195 1..1195 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:56:54 Download gff for MIP06984.complete
Subject Subject Range Query Range Percent Splice Strand
CG32428-RC 44..1238 1..1195 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:43:04 Download gff for MIP06984.complete
Subject Subject Range Query Range Percent Splice Strand
CG32428-RC 44..1238 1..1195 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:43:04 Download gff for MIP06984.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20472641..20473329 1..689 100   Minus
3L 20470954..20471148 690..884 100 <- Minus
3L 20469674..20469984 885..1195 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:56:54 Download gff for MIP06984.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20465741..20466429 1..689 100   Minus
arm_3L 20464054..20464248 690..884 100 <- Minus
arm_3L 20462774..20463084 885..1195 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:14:08 Download gff for MIP06984.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20465741..20466429 1..689 100   Minus
3L 20464054..20464248 690..884 100 <- Minus
3L 20462774..20463084 885..1195 100 <- Minus

MIP06984.pep Sequence

Translation from 355 to 1071

> MIP06984.pep
MVLTNFECWAHGDPSSSAAATFETGALRPSMDPFNPRAVTFMTDANNNNN
NNDGNNLAAQPMPVVLPPEVLRCKKRLNPGHNPVGDLDTDQPVYTKRCRY
DESDLAAQYCNDFFSLPATQIIGTQASLMDYEMQATGGMMMMESETSFPA
QQQQHQEQQQHPQQPHQYQRIHQHYQESAEQRVPSPQQKSRKSNNSIGKI
KLKSIGSEAEADLYIATHGGSLHHFCGLGGSELEESDI*

MIP06984.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 17:37:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24128-PA 189 GF24128-PA 1..134 1..135 451 70 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 17:37:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13306-PA 188 GG13306-PA 1..145 1..150 682 88 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 17:37:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17014-PA 224 GH17014-PA 1..205 1..176 271 38.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 17:37:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG32428-PC 238 CG32428-PC 1..238 1..238 1277 100 Plus
CG32428-PB 195 CG32428-PB 1..176 1..176 961 100 Plus
CG32428-PA 195 CG32428-PA 1..176 1..176 961 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 17:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11908-PA 226 GI11908-PA 1..160 1..132 275 41.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 17:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12773-PA 188 GL12773-PA 1..153 1..145 411 56.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 17:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16894-PA 187 GA16894-PA 1..153 1..145 411 56.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 17:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22210-PA 195 GM22210-PA 1..176 1..176 769 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 17:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12182-PA 193 GD12182-PA 1..174 1..176 779 92.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 17:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13782-PA 214 GJ13782-PA 1..195 1..176 250 40.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 17:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12339-PA 204 GK12339-PA 1..156 1..133 263 48.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 17:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22396-PA 185 GE22396-PA 1..145 1..150 708 90 Plus

MIP06984.hyp Sequence

Translation from 355 to 1071

> MIP06984.hyp
MVLTNFECWAHGDPSSSAAATFETGALRPSMDPFNPRAVTFMTDANNNNN
NNDGNNLAAQPMPVVLPPEVLRCKKRLNPGHNPVGDLDTDQPVYTKRCRY
DESDLAAQYCNDFFSLPATQIIGTQASLMDYEMQATGGMMMMESETSFPA
QQQQHQEQQQHPQQPHQYQRIHQHYQESAEQRVPSPQQKSRKSNNSIGKI
KLKSIGSEAEADLYIATHGGSLHHFCGLGGSELEESDI*

MIP06984.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG32428-PC 238 CG32428-PC 1..238 1..238 1277 100 Plus
CG32428-PB 195 CG32428-PB 1..176 1..176 961 100 Plus
CG32428-PA 195 CG32428-PA 1..176 1..176 961 100 Plus