Clone MIP07023 Report

Search the DGRC for MIP07023

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:70
Well:23
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42831-RA
Protein status:MIP07023.pep: gold
Sequenced Size:1285

Clone Sequence Records

MIP07023.complete Sequence

1285 bp assembled on 2009-03-11

GenBank Submission: BT072882.1

> MIP07023.complete
AGAAAACTGTCAGCATATGTTCCATAGGGCTTATGGTATACCCCAAAGAT
GAAGCCACAAAGTCCCAAAACGAATACAGCGCGCGGCAGCGAGAGACAAG
GCATAAAAATAAATGAATAACATAAAAATAAATCATACGCCCCATCGGCC
ACCCAGTAAAAAGTAAGCCAATACCGTAACCATTACCCTCGCTTCAAAAT
CACACCCCAAACCCAAACTCGAACCCAATGGATGTTCTCCCCCTATTTTC
ATGGCGCTAATAAATGCTTATCGAAGACGCATAAAGCGAGTAAATTCGCA
GCCATTAAACGGGCATAAAACTCGAAGCCGGGGCCGAAGCGAAATTGTGG
GGCCGACAAATCAAAGTACAAGCCTCAGGACCAACCTCATTCTCCTATTT
CCCAGCCATGAAATAAAACCAGGCAACAATGAAACCCAAAGCGTCTCCCA
AGCGATTTCAATGCGGGCATTCATCGGTCGAGCCAAGGAATTGGCCACCC
ACAAGACCCAAAACCCAGAACCCAAACTTCCAGTGAACCTTCCACCCTCG
TCACCTCCAGCACCCCATTTAAAGGCCCTTCCTTCGAGGCAACACTCGCT
ATATAACCATCTTACCCAACGTTGACAGCATACAAAGTAACTTAAATCGA
AACAATAAAGCGGCAACTTTGTACCAAGAAAAAATGCAAAAGAAAGCAAA
ATGAACACAGGAAAAACGTGAAAGAAAGCTCGAAAAGGAACCAGAAAAAG
TGTGGAAATGAGAAACAAGCGAAGTAGGTTATACCCTCATGATTTCTATA
CTATTTGAAAACATATTACAATGGCTCATCTAACAATCTGATTATTAATA
TACTAGTACATTGCATCAACTTCACTTTTTAAGGAAATCGATTATGTAGC
ATGAAAGAGAAAATTCAATACCAATTAGGGTATTCGAAGCACCATAAAAC
ACCAATGTTTAAGCTTCCGATCGAAATTCCCATACCAAGCGTGGGTATTA
TTACAAAAAACGTTGGAAAAGACGTCAAGGAAAGTTCCCAAAGAAATTGA
GCTGCAGGCGGAGGGAAAGCGGAGAAAGGGGCGAAAAAAGAAATGTAGAA
AAGCGCAAATAAATGAATGAATAAAAACGCCAAGGATAGCGAGGATACCA
TACAGGCAAAGGCAAACTCATAGTGCACGGATAGAAGGGAGGCAAAGGAA
CAGAGTTCCACAAAGAAATTACAAAATGTATGCAACAAAAAAAATAAAAA
AAATAAAAAGCGTTGGAAAAAAAAAAAAAAAAAAA

MIP07023.complete Blast Records

Blast to MB8.fasta performed on 2010-07-15 21:26:51 has no hits.
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 10805966..10807232 1..1266 6000 98.7 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG42831-RA 375 CG42831-PA 1..375 251..625 1875 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:10 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:42:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG42831-RA 1266 CG42831-RA 1..1266 1..1266 6330 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG42831-PA 124 CG42831-PA 1..124 251..622 503 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 10814819..10816088 1..1270 6350 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 10807919..10809188 1..1270 6350 100 Plus
Blast to na_te.dros performed on 2014-11-26 19:42:21 has no hits.

MIP07023.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:14:31 Download gff for MIP07023.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 10805966..10807232 1..1266 98   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:40:18 Download gff for MIP07023.complete
Subject Subject Range Query Range Percent Splice Strand
CG42831-RA 1..375 251..625 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:48:56 Download gff for MIP07023.complete
Subject Subject Range Query Range Percent Splice Strand
CG42831-RA 1..375 251..625 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:14:31 Download gff for MIP07023.complete
Subject Subject Range Query Range Percent Splice Strand
CG42831-RA 1..375 251..625 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:40:18 Download gff for MIP07023.complete
Subject Subject Range Query Range Percent Splice Strand
CG42831-RA 1..1266 1..1266 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:48:56 Download gff for MIP07023.complete
Subject Subject Range Query Range Percent Splice Strand
CG42831-RA 1..1266 1..1266 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:14:31 Download gff for MIP07023.complete
Subject Subject Range Query Range Percent Splice Strand
CG42831-RA 1..1266 1..1266 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:14:31 Download gff for MIP07023.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10814819..10816084 1..1266 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:48:56 Download gff for MIP07023.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 10807919..10809184 1..1266 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:14:34 Download gff for MIP07023.complete
Subject Subject Range Query Range Percent Splice Strand
3L 10807919..10809184 1..1266 100   Plus

MIP07023.pep Sequence

Translation from 250 to 624

> MIP07023.pep
MALINAYRRRIKRVNSQPLNGHKTRSRGRSEIVGPTNQSTSLRTNLILLF
PSHEIKPGNNETQSVSQAISMRAFIGRAKELATHKTQNPEPKLPVNLPPS
SPPAPHLKALPSRQHSLYNHLTQR*

MIP07023.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:51:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG42831-PA 124 CG42831-PA 1..124 1..124 640 100 Plus

MIP07023.hyp Sequence

Translation from 250 to 624

> MIP07023.hyp
MALINAYRRRIKRVNSQPLNGHKTRSRGRSEIVGPTNQSTSLRTNLILLF
PSHEIKPGNNETQSVSQAISMRAFIGRAKELATHKTQNPEPKLPVNLPPS
SPPAPHLKALPSRQHSLYNHLTQR*

MIP07023.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG42831-PA 124 CG42831-PA 1..124 1..124 640 100 Plus