Clone MIP07042 Report

Search the DGRC for MIP07042

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:70
Well:42
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptDen1-RC
Protein status:MIP07042.pep: gold
Sequenced Size:1182

Clone Sequence Records

MIP07042.complete Sequence

1182 bp assembled on 2009-03-11

GenBank Submission: BT072883.1

> MIP07042.complete
CAAAAGCAAAAGGAAACCGAAAACGTCATTCCTGCGTTGACTTTGAAACC
CTGGAGTTGTATTAGTCGCCGGAAAAATTTTATTCTTTTAGCCGAATTTT
CGCGAAGATTGTTAGTGAAAATGTTGCCCCACGATAGGAAAATACTTAGG
CAACATACACGCCAGAACCAGAATACGAATCGCCGGCGCCCCAGATTCAC
CAACAATAGCTTCCATACCAAAATGGGCAGCAACTCCAAGGCAGACCCCA
TCTCGCTGACCTTCCACGACTCCTGCCTGCGGATGTCCGACGTCCAGTTG
CTCCACGGCCCGCACTGGCTGAACGACCAGATCCTGAGCTTCTACTACGA
ATACCTGGCCCACATGAAGTACAAGACCAATGCGGATCTGCACTTCATTG
CGCCGGAGATTACGCAGTGTATGAAGTACATGGGCGACCAGGAGCTGAAG
CAGCTTCTCGACCAGAGCAACACCACTGGCAAGCCCTTTATCTTCTTCGC
GCTGAACGACAACGAAACCACCGATGCTGGTGGCAGCCACTGGTCACTGT
TGGTCTTCTCGCGTCCGGAGAAGACCTTCTATCACTTCGATTCGTATGGG
AACAACAACACGGGCAACTCCCTGGAGCTGATGAACAAGATCAAGGACCT
GCTTGGCGTCCGAATGGCCAAATTCCGGCCCATGCGCTGCCTACAGCAGG
CGAACGGCTACGACTGTGGCATCCATGTTATCTGCATGACCGACCACATT
GCCGATTACCTAAACAGATACGAGGTGATCGACGGACTGCCGTCGCTGCA
CATCGACACCGTGAAGGCGAAGCGCACCGAGCTACTGAAACTCATCCTGT
CGCTGGGCGGCAAGGGCTAGAGGCTAGCGAGGATTGCCCTGCCGAACCGC
CCACAGCCGAGTAGTTTTTAAGTGACCAAATTACGAATGTAACTCGTTGC
CGAAGAATGAGAGGAGCATCGGAATTACATATGTGAATACGATATCCATG
ATATCGCTAGTTGTAGTGGGTTTAGTTTTCCTTGCCGAATGAAAATGTTT
AAAAAACAAAAGCAAACTAAAAGCAATTGAGGCGGTGAGTCGGCATATTT
TTAAGGTTGGTCTTTCAAAATAAAGATTTGTTTAGCCACAAAACGCGTTG
GCTTCGAATTCAAAAAAAAAAAAAAAAAAAAA

MIP07042.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:45
Subject Length Description Subject Range Query Range Score Percent Strand
Den1-RC 1166 Den1-RC 1..1162 1..1162 5810 100 Plus
Den1.a 1196 Den1.a 179..1192 149..1162 5070 100 Plus
Den1-RB 1079 Den1-RB 66..1079 148..1161 5070 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:38:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8225790..8226803 148..1161 5055 99.9 Plus
chr2R 21145070 chr2R 8225559..8225708 1..150 750 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:38:40
Subject Length Description Subject Range Query Range Score Percent Strand
Den1-RC 750 CG8493-PC 1..750 121..870 3750 100 Plus
Den1-RA 648 CG8493-PA 1..648 223..870 3240 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:14 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:38:39
Subject Length Description Subject Range Query Range Score Percent Strand
Den1-RC 1161 CG8493-RC 1..1161 1..1161 5805 100 Plus
Den1-RA 1257 CG8493-RA 245..1257 149..1161 5065 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
Den1-PC 249 CG8493-PC 1..237 121..831 1156 100 Plus
Den1-PA 215 CG8493-PA 1..203 223..831 1100 100 Plus
CG1503-PB 307 CG1503-PB 88..288 250..828 292 34.3 Plus
CG1503-PA 307 CG1503-PA 88..288 250..828 292 34.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12338531..12339545 148..1162 5075 100 Plus
2R 25286936 2R 12338300..12338449 1..150 750 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:37
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12339730..12340744 148..1162 5075 100 Plus
2R 25260384 2R 12339499..12339648 1..150 750 100 Plus
Blast to na_te.dros performed on 2014-11-26 19:38:38 has no hits.

MIP07042.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:00:01 Download gff for MIP07042.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8225792..8226803 150..1161 99   Plus
chr2R 8225559..8225707 1..149 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:52:31 Download gff for MIP07042.complete
Subject Subject Range Query Range Percent Splice Strand
CG8493-RB 1..648 223..870 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:40:11 Download gff for MIP07042.complete
Subject Subject Range Query Range Percent Splice Strand
Den1-RC 1..750 121..870 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:57:03 Download gff for MIP07042.complete
Subject Subject Range Query Range Percent Splice Strand
Den1-RC 1..750 121..870 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:00:01 Download gff for MIP07042.complete
Subject Subject Range Query Range Percent Splice Strand
Den1-RC 1..750 121..870 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-11 13:19:24 Download gff for MIP07042.complete
Subject Subject Range Query Range Percent Splice Strand
CG8493-RB 61..1079 142..1161 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:40:11 Download gff for MIP07042.complete
Subject Subject Range Query Range Percent Splice Strand
Den1-RC 1..1161 1..1161 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:57:03 Download gff for MIP07042.complete
Subject Subject Range Query Range Percent Splice Strand
Den1-RC 1..1161 1..1161 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:00:01 Download gff for MIP07042.complete
Subject Subject Range Query Range Percent Splice Strand
Den1-RC 1..1161 1..1161 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:00:01 Download gff for MIP07042.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12338533..12339544 150..1161 100   Plus
2R 12338300..12338448 1..149 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:57:03 Download gff for MIP07042.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8226038..8227049 150..1161 100   Plus
arm_2R 8225805..8225953 1..149 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:14:26 Download gff for MIP07042.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12339732..12340743 150..1161 100   Plus
2R 12339499..12339647 1..149 100 -> Plus

MIP07042.pep Sequence

Translation from 0 to 869

> MIP07042.pep
QKQKETENVIPALTLKPWSCISRRKNFILLAEFSRRLLVKMLPHDRKILR
QHTRQNQNTNRRRPRFTNNSFHTKMGSNSKADPISLTFHDSCLRMSDVQL
LHGPHWLNDQILSFYYEYLAHMKYKTNADLHFIAPEITQCMKYMGDQELK
QLLDQSNTTGKPFIFFALNDNETTDAGGSHWSLLVFSRPEKTFYHFDSYG
NNNTGNSLELMNKIKDLLGVRMAKFRPMRCLQQANGYDCGIHVICMTDHI
ADYLNRYEVIDGLPSLHIDTVKAKRTELLKLILSLGGKG*

MIP07042.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 23:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19818-PA 215 GF19818-PA 1..215 75..289 1091 91.2 Plus
Dana\GF21854-PA 318 GF21854-PA 98..310 77..287 317 34.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 23:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20277-PA 215 GG20277-PA 1..215 75..289 1137 96.7 Plus
Dere\GG17555-PA 319 GG17555-PA 90..311 76..287 343 34.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 23:54:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22812-PA 212 GH22812-PA 2..211 79..288 974 82.9 Plus
Dgri\GH22976-PA 212 GH22976-PA 2..211 79..288 769 65.2 Plus
Dgri\GH24159-PA 318 GH24159-PA 96..311 74..285 587 48.6 Plus
Dgri\GH12897-PA 328 GH12897-PA 113..326 77..289 527 48.4 Plus
Dgri\GH16114-PA 285 GH16114-PA 18..244 59..287 348 34.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:54:12
Subject Length Description Subject Range Query Range Score Percent Strand
Den1-PC 249 CG8493-PC 1..249 41..289 1343 100 Plus
Den1-PA 215 CG8493-PA 1..215 75..289 1156 100 Plus
CG1503-PB 307 CG1503-PB 53..299 55..287 335 33.6 Plus
CG1503-PA 307 CG1503-PA 53..299 55..287 335 33.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 23:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21188-PA 212 GI21188-PA 2..211 79..288 976 81.9 Plus
Dmoj\GI18461-PA 195 GI18461-PA 1..193 95..287 841 77.2 Plus
Dmoj\GI15294-PA 349 GI15294-PA 126..346 67..286 733 58.4 Plus
Dmoj\GI14319-PA 262 GI14319-PA 50..248 84..287 375 36.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 23:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10824-PA 215 GL10824-PA 1..214 75..288 1007 84.1 Plus
Dper\GL16580-PA 300 GL16580-PA 74..281 84..287 295 32.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 23:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21116-PA 215 GA21116-PA 1..214 75..288 1007 84.1 Plus
Dpse\GA13447-PA 302 GA13447-PA 76..283 84..287 291 32.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 23:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21362-PA 215 GM21362-PA 1..215 75..289 1165 99.5 Plus
Dsec\GM22639-PA 317 GM22639-PA 97..309 84..287 275 32.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 23:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10859-PA 215 GD10859-PA 1..215 75..289 1165 99.5 Plus
Dsim\GD24436-PA 316 GD24436-PA 97..308 84..287 342 35.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 23:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20790-PA 212 GJ20790-PA 2..211 79..288 982 83.3 Plus
Dvir\GJ21548-PA 212 GJ21548-PA 2..210 79..287 896 75.6 Plus
Dvir\GJ16998-PA 377 GJ16998-PA 159..374 72..286 721 59.7 Plus
Dvir\GJ19377-PA 264 GJ19377-PA 36..242 76..287 393 37.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 23:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22166-PA 263 GK22166-PA 1..262 41..288 1039 74 Plus
Dwil\GK10100-PA 308 GK10100-PA 92..306 74..287 742 60.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 23:54:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12437-PA 215 GE12437-PA 1..215 75..289 1147 96.7 Plus
Dyak\GE15316-PA 296 GE15316-PA 75..288 84..287 340 35.9 Plus

MIP07042.hyp Sequence

Translation from 0 to 869

> MIP07042.hyp
QKQKETENVIPALTLKPWSCISRRKNFILLAEFSRRLLVKMLPHDRKILR
QHTRQNQNTNRRRPRFTNNSFHTKMGSNSKADPISLTFHDSCLRMSDVQL
LHGPHWLNDQILSFYYEYLAHMKYKTNADLHFIAPEITQCMKYMGDQELK
QLLDQSNTTGKPFIFFALNDNETTDAGGSHWSLLVFSRPEKTFYHFDSYG
NNNTGNSLELMNKIKDLLGVRMAKFRPMRCLQQANGYDCGIHVICMTDHI
ADYLNRYEVIDGLPSLHIDTVKAKRTELLKLILSLGGKG*

MIP07042.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:09:51
Subject Length Description Subject Range Query Range Score Percent Strand
Den1-PC 249 CG8493-PC 1..249 41..289 1343 100 Plus
Den1-PA 215 CG8493-PA 1..215 75..289 1156 100 Plus
CG1503-PB 307 CG1503-PB 53..299 55..287 335 33.6 Plus
CG1503-PA 307 CG1503-PA 53..299 55..287 335 33.6 Plus