Clone MIP07124 Report

Search the DGRC for MIP07124

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:71
Well:24
Vector:pOT2|pOTB7_DraIII
Associated Gene/Transcriptmex1-RB
Protein status:MIP07124.pep: gold
Sequenced Size:781

Clone Sequence Records

MIP07124.complete Sequence

781 bp assembled on 2009-03-10

GenBank Submission: BT072867.1

> MIP07124.complete
ATCAGATCGAAATACGCTAAAATCATTTTCGGGAGCACAATCGAATACTC
ATACAACACACACTTCAAACGAGGATTATCATCATGTGCAACGCCATTTG
TGAATGCCTTAAATGTCCTGGCAAAGTTATTTGCTGCTGCTGTTCCTGCG
CCTGCAAGATGCTCCTGAGCATCGTGTTTTCTGCGCTCCTGATGGTCGTG
GTGATCGGCTTGATTGTCTACTTCACGGTCTTCTATCACAAGGATAAGAA
CACGGATGAGGTGCAGAAGCAGGTCGCCCAACTGACGCCCATTGTGAAGC
GCAGCATACGCGACTACTTCAACAAGGAGTACTGATCTGAGGACATGAAT
TTATACTATAGGCCATATTAATAATAACTCCGTCGAAATCGAAATTGAAA
CGAACTAAGAACCAAAGCCGTTCAGTGCATGACTTAATCTAATCGCGTCG
GATGCTCGTTATGGGATTTTTTCTTATCTATAGATAGTTTGGGACTCAAT
TGAATGGGCAATTTGTGCGTTCTTTAGAAAGGTAGATAATGTTGGAGCGG
CAAAAAATGTGACTCACTGTATACCTTACAATACATTTTGAACTCGAAAC
CCAGTAAAGCATTCACAATATATATTTAATGTATAATATGTATGAATGTA
AGGCAGATTAAAAAAGTTATATTGTACTGGATGACACACTATAAACAAGA
CAATAAAACTAAAATATCTATAGAAAATTGAAAGTGGAAATAATAAATAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP07124.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
nc_12719.a 737 nc_12719.a 1..737 1..737 3685 100 Plus
mex1.a 1205 mex1.a 420..1085 78..743 3210 98.7 Plus
mex1-RA 939 mex1-RA 154..819 78..743 3210 98.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 00:51:04
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15507365..15507977 743..131 3035 99.7 Minus
chr3L 24539361 chr3L 15509395..15509530 136..1 680 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 00:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-RB 252 CG7936-PB 1..252 84..335 1260 100 Plus
mex1-RC 252 CG7936-PC 1..252 84..335 1155 97.2 Plus
mex1-RA 252 CG7936-PA 1..252 84..335 1155 97.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 00:51:01
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-RB 741 CG7936-RB 1..741 1..741 3705 100 Plus
mex1-RC 1034 CG7936-RC 420..1034 78..692 2955 98.7 Plus
mex1-RA 710 CG7936-RA 96..710 78..692 2955 98.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 00:51:03
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-PB 83 CG7936-PB 1..83 84..332 380 100 Plus
mex1-PC 83 CG7936-PC 1..83 84..332 377 97.6 Plus
mex1-PA 83 CG7936-PA 1..83 84..332 377 97.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 00:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15517422..15518034 743..131 3050 99.8 Minus
3L 28110227 3L 15519457..15519592 136..1 680 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:25
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15510522..15511134 743..131 3050 99.8 Minus
3L 28103327 3L 15512557..15512692 136..1 680 100 Minus
3L 28103327 3L 15511408..15511466 136..78 175 86.4 Minus
Blast to na_te.dros performed 2014-11-27 00:51:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dbuz\INE-1 1467 Dbuz\INE-1 ISBU1 1467bp 151..207 691..748 125 70.7 Plus
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 4647..4813 598..748 121 60.1 Plus

MIP07124.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 01:54:31 Download gff for MIP07124.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15509395..15509530 1..136 100   Minus
chr3L 15507361..15507971 137..748 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:52:20 Download gff for MIP07124.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 1..252 84..335 97   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:39:50 Download gff for MIP07124.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RB 1..252 84..335 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:33:03 Download gff for MIP07124.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RB 1..252 84..335 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:54:31 Download gff for MIP07124.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RB 1..252 84..335 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-10 14:34:52 Download gff for MIP07124.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RA 91..721 78..708 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:39:50 Download gff for MIP07124.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RB 1..741 1..741 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:33:03 Download gff for MIP07124.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RB 1..741 1..741 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:54:31 Download gff for MIP07124.complete
Subject Subject Range Query Range Percent Splice Strand
mex1-RB 1..741 1..741 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 01:54:31 Download gff for MIP07124.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15519457..15519592 1..136 100   Minus
3L 15517418..15518028 137..748 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:33:03 Download gff for MIP07124.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15512557..15512692 1..136 100   Minus
arm_3L 15510518..15511128 137..748 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:14:00 Download gff for MIP07124.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15512557..15512692 1..136 100   Minus
3L 15510518..15511128 137..748 99 <- Minus

MIP07124.pep Sequence

Translation from 83 to 334

> MIP07124.pep
MCNAICECLKCPGKVICCCCSCACKMLLSIVFSALLMVVVIGLIVYFTVF
YHKDKNTDEVQKQVAQLTPIVKRSIRDYFNKEY*

MIP07124.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 17:33:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10729-PA 83 GF10729-PA 1..83 1..83 346 88 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 17:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13544-PA 83 GG13544-PA 1..83 1..83 366 95.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 17:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23377-PA 82 GH23377-PA 1..82 1..83 273 73.5 Plus
Dgri\GH17020-PA 82 GH17020-PA 1..82 1..83 273 73.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 17:33:12
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-PB 83 CG7936-PB 1..83 1..83 450 100 Plus
mex1-PC 83 CG7936-PC 1..83 1..83 447 97.6 Plus
mex1-PA 83 CG7936-PA 1..83 1..83 447 97.6 Plus
CG42394-PC 77 CG42394-PC 1..75 5..81 147 36.4 Plus
CG42394-PB 77 CG42394-PB 1..75 5..81 147 36.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 17:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12225-PA 82 GI12225-PA 1..82 1..83 310 69.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 17:33:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20701-PA 83 GA20701-PA 1..83 1..83 271 83.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 17:33:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24487-PA 83 GM24487-PA 1..83 1..83 376 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 17:33:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12559-PA 83 GD12559-PA 1..83 1..83 376 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 17:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11455-PA 82 GJ11455-PA 1..81 1..82 262 72 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 17:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10522-PA 81 GK10522-PA 1..81 1..83 222 63.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 17:33:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22845-PA 83 GE22845-PA 1..83 1..83 366 95.2 Plus
Dyak\GE19847-PA 83 GE19847-PA 1..83 1..83 362 94 Plus

MIP07124.hyp Sequence

Translation from 83 to 334

> MIP07124.hyp
MCNAICECLKCPGKVICCCCSCACKMLLSIVFSALLMVVVIGLIVYFTVF
YHKDKNTDEVQKQVAQLTPIVKRSIRDYFNKEY*

MIP07124.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:00:05
Subject Length Description Subject Range Query Range Score Percent Strand
mex1-PB 83 CG7936-PB 1..83 1..83 450 100 Plus
mex1-PC 83 CG7936-PC 1..83 1..83 447 97.6 Plus
mex1-PA 83 CG7936-PA 1..83 1..83 447 97.6 Plus
CG42394-PC 77 CG42394-PC 1..75 5..81 147 36.4 Plus
CG42394-PB 77 CG42394-PB 1..75 5..81 147 36.4 Plus