Clone MIP07213 Report

Search the DGRC for MIP07213

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:72
Well:13
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43104-RA
Protein status:MIP07213.pep: wuzgold
Sequenced Size:795

Clone Sequence Records

MIP07213.complete Sequence

795 bp assembled on 2009-03-17

GenBank Submission: BT072912.1

> MIP07213.complete
CTTGGCTGAGCAGCTCGACGACGTAGAAGAAACAGCTGAGTCAAGGAGCA
ATGGTGCAACAACTTTGCCGGATAGAACCACGTTGGTTGCAACATGATCG
ATAACCAAGGACTTTTCATCTCACCACTGCAGTGTAGCTGCTTCGGCTGT
AACAATTTGCGGAAATTAGCCAAGGTGTTTTATGGTCATCACCATCGACT
CACCCTCTGTCCACTATTACACTCATCGGATAAAGGAGCCGTGGCACTGC
GAAGTGGATTGTTGTCCGGCAACGTGGAAATGTTTACTTTTTCTTCGGTT
TGCTTTTCCAACACTCTGTACCGAACGATGAGCTGCCTTTGGGGGCTTTT
TAATTGAGGTCTAAGCTGTAATTAAGCAGCTCGGCCTTTTGCCATGTGCT
CTAATTCTATTTTTGCAGTTTAATGAAGTCCTTGGCTGCAGGACGTTCCT
CTGTCCGTCGCTTCTTTCGTCCTTTCGTTACCTGTCACCTGGGCAAATTG
GTTGGCATTATTCATTCACTGTCCTTTAAAGCTCTGGCTAAGGCCAGATC
TGGCCTGCCACCCAGCCGTTGTTCTGACCCGGCTTAAATGCCAATATATC
ACTGGCTAACAACGCTGGTTTCCGTCTGCAGGATTTTAGCTCAAACGGGG
CTAATATACAGTTTTGGATGAAGAAATACATAATGCAAACATACATATTT
TTAACATTTTTTGGTTGCTGAGAAATATGTATTATAATTATGATTAAAAA
TGTTTTTGTTGAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP07213.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
nc_7347.a 761 nc_7347.a 1..761 1..761 3805 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12623993..12624623 764..134 3095 99.4 Minus
chr2R 21145070 chr2R 12624897..12625036 134..1 530 93.6 Minus
Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 10:05:14 has no hits.
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:31 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-27 10:05:13 has no hits.
Blast to dmel-all-translation-r6.02.fasta performed on 2014-11-27 10:05:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16736811..16737443 766..134 3165 100 Minus
2R 25286936 2R 16737717..16737850 134..1 670 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:44:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16738010..16738642 766..134 3165 100 Minus
2R 25260384 2R 16738916..16739049 134..1 670 100 Minus
Blast to na_te.dros performed 2014-11-27 10:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 6843..6938 764..665 139 63 Minus

MIP07213.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:35:35 Download gff for MIP07213.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12624897..12625036 1..134 93   Minus
chr2R 12623993..12624622 135..764 99 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:40:52 Download gff for MIP07213.complete
Subject Subject Range Query Range Percent Splice Strand
CG43104-RA 1..264 94..357 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:37:22 Download gff for MIP07213.complete
Subject Subject Range Query Range Percent Splice Strand
CG43104-RA 1..264 94..357 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:40:52 Download gff for MIP07213.complete
Subject Subject Range Query Range Percent Splice Strand
CG43104-RA 1..764 1..764 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:37:22 Download gff for MIP07213.complete
Subject Subject Range Query Range Percent Splice Strand
CG43104-RA 1..764 1..764 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:35:35 Download gff for MIP07213.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16737717..16737850 1..134 100   Minus
2R 16736813..16737442 135..764 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:35:35 Download gff for MIP07213.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16737717..16737850 1..134 100   Minus
2R 16736813..16737442 135..764 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:35:35 Download gff for MIP07213.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16737717..16737850 1..134 100   Minus
2R 16736813..16737442 135..764 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:37:22 Download gff for MIP07213.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12625222..12625355 1..134 100   Minus
arm_2R 12624318..12624947 135..764 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:15:17 Download gff for MIP07213.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16738916..16739049 1..134 100   Minus
2R 16738012..16738641 135..764 100 <- Minus

MIP07213.pep Sequence

Translation from 93 to 356

> MIP07213.pep
MIDNQGLFISPLQCSCFGCNNLRKLAKVFYGHHHRLTLCPLLHSSDKGAV
ALRSGLLSGNVEMFTFSSVCFSNTLYRTMSCLWGLFN*
Sequence MIP07213.pep has no blast hits.

MIP07213.hyp Sequence

Translation from 93 to 356

> MIP07213.hyp
MIDNQGLFISPLQCSCFGCNNLRKLAKVFYGHHHRLTLCPLLHSSDKGAV
ALRSGLLSGNVEMFTFSSVCFSNTLYRTMSCLWGLFN*
Sequence MIP07213.hyp has no blast hits.