Clone MIP07229 Report

Search the DGRC for MIP07229

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:72
Well:29
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG3841-RA
Protein status:MIP07229.pep: gold
Sequenced Size:2073

Clone Sequence Records

MIP07229.complete Sequence

2073 bp assembled on 2009-03-17

GenBank Submission: BT072914.1

> MIP07229.complete
TAACATGCGGGTGCGCACCACCAAAAAGGGGGAAAAACTAATAAAAATAT
TGCGAAAACTCTGAGAACCGCACAAGATCTCGAACAATTCCCACAGAGAA
TTTTCATTTGAACACTCAGAATGCCTCGATTTTTCCAGTTGACGTGGGCT
CTTCTTTTGATTTTAATAGGTTTCACCACTGCTGTTACTTTTATCGGAGA
TGATCCTGTGGTGGAGCTCTCCTTGGGCAGAATCCAAGGAGATACTATGC
AGAGCTTTGGGAACAAGACAATCTACGCATTCAGAGGAATACGATACGCG
CAATCTCCAGTGGGACAGCTCCGGTTCGCCAATCCAGTTCCGGAAACTAG
TTGGGGTGACGAGGTGTTCAACGCAACATCGGATTCCCTCGTTTGTCCAC
AACCAGGAGTAGTTTCTTTAATGAGTGAAGATTGCCTAAAGATCAACGTT
TTCACGAAGAGCTTCGAGGACAAATTCCCAGTGATGGTGTATATTCATGG
CGGAGCCAATGTCCTGGGAAGTGGACACAGCAGCTATGAAGCAGGACCTC
AATATTTGCTAGATCAGGACGTAGTTTTTGTGGCTTTTAACTATCGCCTT
GGAGCTCTGGGCTTTCTAAGCACAAATAGCAGTGAGACAAAGGGAAACTT
TGGTTTCCTCGATCAGGTGATGGCTCTGGAATGGGTAAGGGATCACATAT
CACACTTTGGTGGTGATCCAGAGTTGGTGACTATTATCGGAATAAGTGCT
GGCTCGATGGCAGTCAGTCTACACTTGGCCTCGCCCCTTTCCGCAGGTCT
CTTCCATCGGGCAATCCTCATGAGTGGATCGGCCACCAATCACTTTGATA
TAGATAACCTTTTTTGGACACGAAAACTGGCTCGTGAGCTGGGTTGTCCA
ATGTATGATCCCACGGATGTGGTGGAGTGTCTCCGAAACGAAACGTGGAC
ACGCATTGTGGAAGTTTGCAAGGCATGGGAAACGTATCAGCTTGTTAATA
TGAAGTGGAACTACGAGATCGATGGACACTTTCTACACAACCATCCTACG
GAGCTAATCAAGGAGGGAAATTTCAACAAGGTTCCCCTGCTAATCAGTTT
CACGGCCAATGAATTCGATTACAATGCAAATGTGCACTTGGAAAACCAGC
ATCTATTACACGATTTTGCCTCAAACTTTGTGGATTATGCCCCAGAGTTG
TTTCTCTATCGCCACGATGCACAAATTGGAGAGAAACTGAAGGATTTTTA
TCTAGGTGACAATACTACGGAAATCAATTCGGAAAACATAGAGAACTTTG
GACAGATCTTTTCTGATGCATATATTGGGCATGGTGTCCATCGTCTGGTC
CAACTAGCTAGTCACTTTACCCCAGTTTATTATACGCGAATGGATTACGT
GGGTGATCAAAGTCTCTCAGCTCCTTTGAATGGTGAAAACAAGCCCGTAG
GAGTGGGCCATGCGGATGATCTGCACTATGTGTTGCCGGGTTATTGGTAT
GGTCCCTTAATGGCGGCAAATGATTCGGATGTTTTTATGATGGAACGTTT
AACCAGCTGGTTTACCCACTTTGCCAAAACAGGGACACCCCTAAACAGCA
CGGATATTTGGCCACCCTGCAACTCGACGGTCTTGAAGATGCTCTACAAC
GGGGTGGTGACCCAGGTGGGTTCGCCCGGCTATTCGAATCGATATGCCGT
CTGGGACAAACTGTTTCCCACGGCCGCCCAGGGCGGAGGCGCTGCCTTGA
AACTCAGTTTCGCCGTGGCCATCGCCACTGGTGTGGCCTCCCGGCTCATC
GGGAAATTAATGTAGCAATTAGGTGTGGAAAAAGCTTATCAATAGGCCGT
TTAGATTACGCTAATGACCTTCGACCGTTGTTCTCGGCTTGCTCTTCGCT
GGAGCAAATGCAGCTATTTACTTTGATTAATTAATCAAGAAAGGCGTGAG
ATTTTCCCTGTTTCCACTGCGAGCTTAGCTTTTCTTTGGGGGCAATTAGT
TATTGGCCTACAGCGGATTGGCTCAGCTTAAATACACATTAATTTGTCTT
TAAAAAAAAAAAAAAAAAAAAAA

MIP07229.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:27:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG3841.a 2092 CG3841.a 39..2092 1..2054 10270 100 Plus
CG3841.c 2797 CG3841.c 747..2797 1..2051 10255 100 Plus
CG3841.b 1953 CG3841.b 26..1953 110..2037 9640 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 9588505..9589527 110..1132 5085 99.8 Plus
chr2L 23010047 chr2L 9590165..9590633 1583..2051 2345 100 Plus
chr2L 23010047 chr2L 9589589..9590041 1132..1584 2265 100 Plus
chr2L 23010047 chr2L 9588326..9588435 1..110 550 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG3841-RB 1695 CG3841-PB 1..1695 121..1815 8475 100 Plus
CG3841-RA 1695 CG3841-PA 1..1695 121..1815 8475 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:35 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG3841-RB 2051 CG3841-RB 1..2051 1..2051 10255 100 Plus
CG3841-RA 1967 CG3841-RA 26..1967 110..2051 9710 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG3841-PB 564 CG3841-PB 1..564 121..1812 2938 100 Plus
CG3841-PA 564 CG3841-PA 1..564 121..1812 2938 100 Plus
CG4757-PB 550 CG4757-PB 9..548 154..1728 777 34.9 Plus
CG4757-PA 550 CG4757-PA 9..548 154..1728 777 34.9 Plus
CG4382-PB 580 CG4382-PB 43..570 202..1719 754 35.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:27:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9589655..9590677 110..1132 5115 100 Plus
2L 23513712 2L 9591315..9591786 1583..2054 2360 100 Plus
2L 23513712 2L 9590739..9591191 1132..1584 2265 100 Plus
2L 23513712 2L 9589476..9589585 1..110 550 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:44:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9589655..9590677 110..1132 5115 100 Plus
2L 23513712 2L 9591315..9591786 1583..2054 2360 100 Plus
2L 23513712 2L 9590739..9591191 1132..1584 2265 100 Plus
2L 23513712 2L 9589476..9589585 1..110 550 100 Plus
Blast to na_te.dros performed on 2014-11-27 09:27:28 has no hits.

MIP07229.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:22:05 Download gff for MIP07229.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 9590166..9590633 1584..2051 100   Plus
chr2L 9589590..9590040 1133..1583 100 -> Plus
chr2L 9588506..9589527 111..1132 99 -> Plus
chr2L 9588326..9588435 1..110 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:07:16 Download gff for MIP07229.complete
Subject Subject Range Query Range Percent Splice Strand
CG3841-RA 1..1695 121..1815 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:40:57 Download gff for MIP07229.complete
Subject Subject Range Query Range Percent Splice Strand
CG3841-RB 1..1695 121..1815 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:22:01 Download gff for MIP07229.complete
Subject Subject Range Query Range Percent Splice Strand
CG3841-RA 1..1695 121..1815 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:22:05 Download gff for MIP07229.complete
Subject Subject Range Query Range Percent Splice Strand
CG3841-RA 1..1695 121..1815 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-17 18:44:27 Download gff for MIP07229.complete
Subject Subject Range Query Range Percent Splice Strand
CG3841-RA 18..1731 100..1815 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:40:57 Download gff for MIP07229.complete
Subject Subject Range Query Range Percent Splice Strand
CG3841-RB 1..2051 1..2051 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:22:01 Download gff for MIP07229.complete
Subject Subject Range Query Range Percent Splice Strand
CG3841-RB 1..2051 1..2051 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:22:05 Download gff for MIP07229.complete
Subject Subject Range Query Range Percent Splice Strand
CG3841-RB 1..2051 1..2051 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:22:05 Download gff for MIP07229.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9591316..9591783 1584..2051 100   Plus
2L 9590740..9591190 1133..1583 100 -> Plus
2L 9589656..9590677 111..1132 100 -> Plus
2L 9589476..9589585 1..110 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:22:01 Download gff for MIP07229.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9591316..9591783 1584..2051 100   Plus
arm_2L 9590740..9591190 1133..1583 100 -> Plus
arm_2L 9589656..9590677 111..1132 100 -> Plus
arm_2L 9589476..9589585 1..110 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:15:23 Download gff for MIP07229.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9591316..9591783 1584..2051 100   Plus
2L 9590740..9591190 1133..1583 100 -> Plus
2L 9589656..9590677 111..1132 100 -> Plus
2L 9589476..9589585 1..110 100 -> Plus

MIP07229.pep Sequence

Translation from 120 to 1814

> MIP07229.pep
MPRFFQLTWALLLILIGFTTAVTFIGDDPVVELSLGRIQGDTMQSFGNKT
IYAFRGIRYAQSPVGQLRFANPVPETSWGDEVFNATSDSLVCPQPGVVSL
MSEDCLKINVFTKSFEDKFPVMVYIHGGANVLGSGHSSYEAGPQYLLDQD
VVFVAFNYRLGALGFLSTNSSETKGNFGFLDQVMALEWVRDHISHFGGDP
ELVTIIGISAGSMAVSLHLASPLSAGLFHRAILMSGSATNHFDIDNLFWT
RKLARELGCPMYDPTDVVECLRNETWTRIVEVCKAWETYQLVNMKWNYEI
DGHFLHNHPTELIKEGNFNKVPLLISFTANEFDYNANVHLENQHLLHDFA
SNFVDYAPELFLYRHDAQIGEKLKDFYLGDNTTEINSENIENFGQIFSDA
YIGHGVHRLVQLASHFTPVYYTRMDYVGDQSLSAPLNGENKPVGVGHADD
LHYVLPGYWYGPLMAANDSDVFMMERLTSWFTHFAKTGTPLNSTDIWPPC
NSTVLKMLYNGVVTQVGSPGYSNRYAVWDKLFPTAAQGGGAALKLSFAVA
IATGVASRLIGKLM*

MIP07229.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 23:37:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22777-PA 812 GF22777-PA 256..812 7..564 2136 68.6 Plus
Dana\GF16733-PA 550 GF16733-PA 1..547 1..535 813 34.6 Plus
Dana\GF21896-PA 577 GF21896-PA 43..570 28..533 794 36.2 Plus
Dana\GF18761-PA 642 GF18761-PA 90..587 30..495 526 32.7 Plus
Dana\GF17297-PA 574 GF17297-PA 36..534 26..499 524 33.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 23:37:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10040-PA 562 GG10040-PA 1..562 1..564 2634 85.5 Plus
Dere\GG17914-PA 565 GG17914-PA 15..563 3..536 826 34.7 Plus
Dere\GG24018-PA 648 GG24018-PA 111..638 28..533 787 36.2 Plus
Dere\GG20569-PA 578 GG20569-PA 17..536 18..513 576 32.1 Plus
Dere\GG12429-PA 644 GG12429-PA 92..603 30..503 531 31.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 23:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10674-PA 567 GH10674-PA 32..546 28..547 1739 61.4 Plus
Dgri\GH18170-PA 547 GH18170-PA 2..542 5..532 828 37.5 Plus
Dgri\GH11055-PA 590 GH11055-PA 47..574 28..533 815 37.4 Plus
Dgri\GH20757-PA 643 GH20757-PA 93..635 30..532 555 31.1 Plus
Dgri\GH22069-PA 507 GH22069-PA 29..507 35..488 534 33.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG3841-PB 564 CG3841-PB 1..564 1..564 3011 100 Plus
CG3841-PA 564 CG3841-PA 1..564 1..564 3011 100 Plus
CG4757-PB 550 CG4757-PB 9..548 12..536 795 34.9 Plus
CG4757-PA 550 CG4757-PA 9..548 12..536 795 34.9 Plus
CG4382-PB 580 CG4382-PB 43..570 28..533 776 36 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 23:37:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11062-PA 565 GI11062-PA 34..565 28..564 1771 60.2 Plus
Dmoj\GI10121-PA 547 GI10121-PA 4..543 12..533 830 36.3 Plus
Dmoj\GI17573-PA 590 GI17573-PA 47..574 28..533 819 37.3 Plus
Dmoj\GI19155-PA 589 GI19155-PA 42..548 34..513 547 33 Plus
Dmoj\GI23477-PA 572 GI23477-PA 31..523 30..498 544 32.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 23:37:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18918-PA 582 GL18918-PA 18..571 23..559 2067 69.5 Plus
Dper\GL19217-PA 561 GL19217-PA 45..551 28..533 807 36.2 Plus
Dper\GL12560-PA 535 GL12560-PA 6..531 11..533 780 35.4 Plus
Dper\GL20599-PA 606 GL20599-PA 52..563 30..513 527 30.9 Plus
Dper\GL13845-PA 754 GL13845-PA 201..746 30..532 523 30.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 23:37:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17724-PA 581 GA17724-PA 18..570 23..559 2077 70.2 Plus
Dpse\GA18409-PA 558 GA18409-PA 18..554 11..533 849 36.6 Plus
Dpse\GA18147-PA 582 GA18147-PA 45..572 28..533 808 36.2 Plus
Dpse\GA10746-PA 575 GA10746-PA 35..575 30..541 533 31 Plus
Dpse\GA19574-PA 582 GA19574-PA 6..541 8..512 527 32.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 23:37:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17558-PA 564 GM17558-PA 1..564 1..564 2910 95.2 Plus
Dsec\GM23920-PA 550 GM23920-PA 23..548 31..536 815 36 Plus
Dsec\GM12374-PA 579 GM12374-PA 42..569 28..533 780 35.5 Plus
Dsec\GM21661-PA 579 GM21661-PA 22..541 18..513 526 32.1 Plus
Dsec\GM10473-PA 568 GM10473-PA 39..564 27..532 511 32.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 23:37:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23616-PA 536 GD23616-PA 1..536 1..564 2694 89.7 Plus
Dsim\GD18733-PA 550 GD18733-PA 23..548 31..536 823 35.8 Plus
Dsim\GD22348-PA 675 GD22348-PA 138..665 28..533 779 35.5 Plus
Dsim\GD11161-PA 579 GD11161-PA 22..541 18..513 546 31.5 Plus
Dsim\GD18378-PA 633 GD18378-PA 92..603 30..503 530 31.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 23:37:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18312-PA 567 GJ18312-PA 33..546 28..546 1815 63.7 Plus
Dvir\GJ23342-PA 547 GJ23342-PA 21..546 31..536 832 36.6 Plus
Dvir\GJ17915-PA 582 GJ17915-PA 39..566 28..533 816 36.6 Plus
Dvir\GJ23121-PA 643 GJ23121-PA 93..602 30..503 551 32 Plus
Dvir\GJ16431-PA 589 GJ16431-PA 34..515 36..490 511 33.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 23:37:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24180-PA 467 GK24180-PA 1..464 101..560 1592 62.9 Plus
Dwil\GK13999-PA 549 GK13999-PA 5..545 11..533 841 36.8 Plus
Dwil\GK23807-PA 587 GK23807-PA 44..571 28..533 828 37.3 Plus
Dwil\GK22895-PA 572 GK22895-PA 6..538 11..513 545 33 Plus
Dwil\GK13419-PA 650 GK13419-PA 98..642 30..532 544 31 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 23:37:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18855-PA 522 GE18855-PA 1..522 43..564 2494 86.8 Plus
Dyak\GE26073-PA 550 GE26073-PA 23..548 31..536 837 36.4 Plus
Dyak\GE10446-PA 580 GE10446-PA 43..570 28..533 782 35.8 Plus
Dyak\GE11755-PA 581 GE11755-PA 20..539 18..513 548 32 Plus
Dyak\GE25783-PA 568 GE25783-PA 38..564 26..532 529 32.4 Plus

MIP07229.hyp Sequence

Translation from 120 to 1814

> MIP07229.hyp
MPRFFQLTWALLLILIGFTTAVTFIGDDPVVELSLGRIQGDTMQSFGNKT
IYAFRGIRYAQSPVGQLRFANPVPETSWGDEVFNATSDSLVCPQPGVVSL
MSEDCLKINVFTKSFEDKFPVMVYIHGGANVLGSGHSSYEAGPQYLLDQD
VVFVAFNYRLGALGFLSTNSSETKGNFGFLDQVMALEWVRDHISHFGGDP
ELVTIIGISAGSMAVSLHLASPLSAGLFHRAILMSGSATNHFDIDNLFWT
RKLARELGCPMYDPTDVVECLRNETWTRIVEVCKAWETYQLVNMKWNYEI
DGHFLHNHPTELIKEGNFNKVPLLISFTANEFDYNANVHLENQHLLHDFA
SNFVDYAPELFLYRHDAQIGEKLKDFYLGDNTTEINSENIENFGQIFSDA
YIGHGVHRLVQLASHFTPVYYTRMDYVGDQSLSAPLNGENKPVGVGHADD
LHYVLPGYWYGPLMAANDSDVFMMERLTSWFTHFAKTGTPLNSTDIWPPC
NSTVLKMLYNGVVTQVGSPGYSNRYAVWDKLFPTAAQGGGAALKLSFAVA
IATGVASRLIGKLM*

MIP07229.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:02:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG3841-PB 564 CG3841-PB 1..564 1..564 3011 100 Plus
CG3841-PA 564 CG3841-PA 1..564 1..564 3011 100 Plus
CG4757-PB 550 CG4757-PB 9..548 12..536 795 34.9 Plus
CG4757-PA 550 CG4757-PA 9..548 12..536 795 34.9 Plus
CG4382-PB 580 CG4382-PB 43..570 28..533 776 36 Plus