Clone MIP07382 Report

Search the DGRC for MIP07382

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:73
Well:82
Vector:pOT2|pOTB7_DraIII
Associated Gene/Transcriptgalectin-RE
Protein status:MIP07382.pep: gold
Sequenced Size:1479

Clone Sequence Records

MIP07382.complete Sequence

1479 bp assembled on 2009-03-19

GenBank Submission: BT072952.1

> MIP07382.complete
TTGCCGCGAGCGTCAGCCCTCAAGGCATCGGAAGGCACACATTGATTTTG
CAGCTATTGAGGCGAGTGTATACTGTGACCGAAATATGGATGCCTTGGAC
GGTACGACAATGGAACTGCACAACAGTTTTCTACAGGTGGAGAGCACAAC
ACACTTTCCTTTGGATTGCATCAGCGACATCGAGGTGGTGGATGGAAATG
AATTAAAAGCCTCATTTTACGAATATGCAGATGCTGTGCCAAAATATTTT
AACGACCAAATAGGGAAATTGAGCGAAGGGATAAGTTTCACGGTGACTGG
GAATCTCTCTGTAAACTGCGAGAGGTTTTCCATCAATCTGGTTTATAACA
ATGACTCTCGAGATGTGGCGCTCCACATTAATCCACGGTTGCCACAAAAC
TATATTGTCCGCAACACCAAAGTACAGGACATTTGGGGAAACGAGGAAGT
GTCCTCGGCATTGCCGTTTCTACTAAGTCGAGGCGAGGAGTTTTCCATTC
AAGTGCTAGTTACTGAGGCATGCTATATGATATCGGTAAACGGACAACAC
TTTGCAGCGTACACTCATCGAATCCCTTATAGGGATGTTCGCATTCTGGA
AGTGAAGGGAGATGTAAGTAACGTGGAAATGAAGCGAACTTTGGTCTTAA
AATATCCTGAGCGATTACCCCAGTCAGAGGCTAATAACATTGAGCTTCAC
ATAGATGATGGGATTAATGAAATTGATGCCAGCGTTGAGGAGACTGTTAA
AATACCTCATGAGTGGTGCATTATTAGCGCCCCGAACACACAGTCGGACA
GTTCGCCTAAGCGTAACAATAGTTCGAATGATCTTGGCCTTACTTTGCCT
TATTATGGAGCATTGCCACCAAATTCGTTGGTCGATGGTCGATGCTTGAA
GATTGAAGGGAGAGTGCGATTACTTCCCCACTCGTTTTATATAAACCTGC
AACAGGGGCAGGACATATGGCCACATCCAGTAATTGCATTCCACTTAAAC
CCACGTTTTTCGAAAGCAAGCAGCGGCGCTATTGGAAAGGCGGTGGTGTG
TAGGAATGCCTGGCTTAATGGAGCTTGGGCACAAGAAGAGCGTTCGGAGT
TTGACACAAACTTTCGCCCTGGTCGGTCTTTTTGTTTAGCCATTGTTTGT
ACCAAAACATCCTTTGAGGTGTATGTCAATCGGCAGTTTATGACTGATTT
TAAATATAAGGTTAGCCCTGAGGTGGTGGACACTGTCTACATACAAGGAG
ATGTTAAACTTTGGAATGTAACGCTGGAAAAAAATCAGATGATTAAAGGC
AAAAATATGCGAGTCTATCAGAATCCGTGGTTCTTTAGTGAGTAGTAGCT
GTTCATGTTTTTATTTTTTAGTAGTTTAGCGACAATAAAAAAGTGATACG
CTCGTGTTTCATTATACAATATTTTTGTTAATAAATAAAATTATGGTAAC
GTCATCCGAAAAAAAAAAAAAAAAAAAAA

MIP07382.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:27:40
Subject Length Description Subject Range Query Range Score Percent Strand
galectin.g 2651 galectin.g 1133..2591 1..1459 7295 100 Plus
galectin.d 2693 galectin.d 1175..2633 1..1459 7295 100 Plus
galectin.c 2650 galectin.c 1132..2590 1..1459 7295 100 Plus
galectin.g 2651 galectin.g 438..626 21..209 585 87.3 Plus
galectin.d 2693 galectin.d 480..668 21..209 585 87.3 Plus
galectin.c 2650 galectin.c 437..625 21..209 585 87.3 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 75090..76225 323..1458 5680 100 Plus
chr2L 23010047 chr2L 73499..73707 1..209 1045 100 Plus
chr2L 23010047 chr2L 74917..75034 209..326 590 100 Plus
chr2L 23010047 chr2L 72804..72992 21..209 585 87.3 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
galectin-RE 1260 CG11372-PE 1..1260 86..1345 6300 100 Plus
galectin-RA 1512 CG11372-PA 188..1512 21..1345 6265 98.2 Plus
galectin-RD 1206 CG11372-PD 70..1206 209..1345 5685 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:45 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:28:28
Subject Length Description Subject Range Query Range Score Percent Strand
galectin-RE 1458 CG11372-RE 1..1458 1..1458 7290 100 Plus
galectin-RA 1841 CG11372-RA 404..1841 21..1458 6830 98.3 Plus
galectin-RF 1536 CG11372-RF 287..1536 209..1458 6250 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
galectin-PE 419 CG11372-PE 1..415 86..1330 2198 100 Plus
galectin-PA 503 CG11372-PA 49..499 2..1330 2196 93.8 Plus
galectin-PB 402 CG11372-PB 24..398 206..1330 1985 99.7 Plus
galectin-PD 401 CG11372-PD 24..397 209..1330 1984 100 Plus
galectin-PF 272 CG11372-PF 1..268 527..1330 1433 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:28:25
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 75076..76212 323..1459 5685 100 Plus
2L 23513712 2L 73485..73693 1..209 1045 100 Plus
2L 23513712 2L 74903..75020 209..326 590 100 Plus
2L 23513712 2L 72790..72978 21..209 585 87.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 75076..76212 323..1459 5685 100 Plus
2L 23513712 2L 73485..73693 1..209 1045 100 Plus
2L 23513712 2L 74903..75020 209..326 590 100 Plus
2L 23513712 2L 72790..72978 21..209 585 87.3 Plus
Blast to na_te.dros performed on 2014-11-27 09:28:27 has no hits.

MIP07382.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:22:18 Download gff for MIP07382.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 75092..76225 325..1458 100   Plus
chr2L 74917..75032 209..324 100 -> Plus
chr2L 73499..73706 1..208 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:07:32 Download gff for MIP07382.complete
Subject Subject Range Query Range Percent Splice Strand
galectin-RA 181..1512 13..1345 97   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:41:28 Download gff for MIP07382.complete
Subject Subject Range Query Range Percent Splice Strand
galectin-RE 1..1260 86..1345 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:23:16 Download gff for MIP07382.complete
Subject Subject Range Query Range Percent Splice Strand
galectin-RE 1..1260 86..1345 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:22:18 Download gff for MIP07382.complete
Subject Subject Range Query Range Percent Splice Strand
galectin-RE 1..1260 86..1345 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-19 16:36:28 Download gff for MIP07382.complete
Subject Subject Range Query Range Percent Splice Strand
galectin-RA 396..1832 13..1450 98   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:41:28 Download gff for MIP07382.complete
Subject Subject Range Query Range Percent Splice Strand
galectin-RE 1..1458 1..1458 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:23:16 Download gff for MIP07382.complete
Subject Subject Range Query Range Percent Splice Strand
galectin-RE 1..1458 1..1458 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:22:18 Download gff for MIP07382.complete
Subject Subject Range Query Range Percent Splice Strand
galectin-RE 1..1458 1..1458 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:22:18 Download gff for MIP07382.complete
Subject Subject Range Query Range Percent Splice Strand
2L 75078..76211 325..1458 100   Plus
2L 74903..75018 209..324 100 -> Plus
2L 73485..73692 1..208 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:23:16 Download gff for MIP07382.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 75078..76211 325..1458 100   Plus
arm_2L 74903..75018 209..324 100 -> Plus
arm_2L 73485..73692 1..208 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:16:00 Download gff for MIP07382.complete
Subject Subject Range Query Range Percent Splice Strand
2L 75078..76211 325..1458 100   Plus
2L 74903..75018 209..324 100 -> Plus
2L 73485..73692 1..208 100 -> Plus

MIP07382.hyp Sequence

Translation from 0 to 1344

> MIP07382.hyp
CRERQPSRHRKAHIDFAAIEASVYCDRNMDALDGTTMELHNSFLQVESTT
HFPLDCISDIEVVDGNELKASFYEYADAVPKYFNDQIGKLSEGISFTVTG
NLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVRNTKVQDIWGNEEV
SSALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILE
VKGDVSNVEMKRTLVLKYPERLPQSEANNIELHIDDGINEIDASVEETVK
IPHEWCIISAPNTQSDSSPKRNNSSNDLGLTLPYYGALPPNSLVDGRCLK
IEGRVRLLPHSFYINLQQGQDIWPHPVIAFHLNPRFSKASSGAIGKAVVC
RNAWLNGAWAQEERSEFDTNFRPGRSFCLAIVCTKTSFEVYVNRQFMTDF
KYKVSPEVVDTVYIQGDVKLWNVTLEKNQMIKGKNMRVYQNPWFFSE*

MIP07382.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:00:47
Subject Length Description Subject Range Query Range Score Percent Strand
galectin-PE 419 CG11372-PE 1..419 29..447 2219 100 Plus
galectin-PA 503 CG11372-PA 49..503 1..447 2217 93.8 Plus
galectin-PB 402 CG11372-PB 24..402 69..447 2006 99.7 Plus
galectin-PD 401 CG11372-PD 24..401 70..447 2005 100 Plus
galectin-PF 272 CG11372-PF 1..272 176..447 1454 100 Plus

MIP07382.pep Sequence

Translation from 1 to 1344

> MIP07382.pep
CRERQPSRHRKAHIDFAAIEASVYCDRNMDALDGTTMELHNSFLQVESTT
HFPLDCISDIEVVDGNELKASFYEYADAVPKYFNDQIGKLSEGISFTVTG
NLSVNCERFSINLVYNNDSRDVALHINPRLPQNYIVRNTKVQDIWGNEEV
SSALPFLLSRGEEFSIQVLVTEACYMISVNGQHFAAYTHRIPYRDVRILE
VKGDVSNVEMKRTLVLKYPERLPQSEANNIELHIDDGINEIDASVEETVK
IPHEWCIISAPNTQSDSSPKRNNSSNDLGLTLPYYGALPPNSLVDGRCLK
IEGRVRLLPHSFYINLQQGQDIWPHPVIAFHLNPRFSKASSGAIGKAVVC
RNAWLNGAWAQEERSEFDTNFRPGRSFCLAIVCTKTSFEVYVNRQFMTDF
KYKVSPEVVDTVYIQGDVKLWNVTLEKNQMIKGKNMRVYQNPWFFSE*

MIP07382.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 15:54:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15050-PA 497 GF15050-PA 49..496 1..447 1676 68.2 Plus
Dana\GF15051-PA 389 GF15051-PA 33..367 93..428 657 38 Plus
Dana\GF11976-PA 321 GF11976-PA 14..140 86..209 152 29.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 15:54:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24692-PA 503 GG24692-PA 49..503 1..447 2145 88.8 Plus
Dere\GG13329-PA 1348 GG13329-PA 813..950 283..423 154 31.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 15:54:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11722-PA 495 GH11722-PA 62..494 2..447 1548 62.3 Plus
Dgri\GH11723-PA 386 GH11723-PA 44..374 93..430 673 39.4 Plus
Dgri\GH14254-PA 2613 GH14254-PA 215..380 57..222 460 50 Plus
Dgri\GH20302-PA 321 GH20302-PA 14..157 86..227 157 27.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:54:06
Subject Length Description Subject Range Query Range Score Percent Strand
galectin-PE 419 CG11372-PE 1..419 29..447 2219 100 Plus
galectin-PA 503 CG11372-PA 49..503 1..447 2217 93.8 Plus
galectin-PB 402 CG11372-PB 24..402 69..447 2006 99.7 Plus
galectin-PD 401 CG11372-PD 24..401 70..447 2005 100 Plus
galectin-PF 272 CG11372-PF 1..272 176..447 1454 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 15:54:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16246-PA 488 GI16246-PA 71..482 12..442 1501 61.9 Plus
Dmoj\GI23146-PA 672 GI23146-PA 373..654 87..420 330 29.5 Plus
Dmoj\GI23146-PA 672 GI23146-PA 526..670 82..226 279 38.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 15:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16594-PA 503 GL16594-PA 63..502 7..447 1795 73 Plus
Dper\GL25042-PA 1348 GL25042-PA 814..951 283..423 158 31.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 15:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10954-PB 503 GA10954-PB 63..502 7..447 1795 73 Plus
Dpse\GA10955-PB 392 GA10955-PB 44..380 93..430 697 39.5 Plus
Dpse\GA16767-PA 1348 GA16767-PA 814..951 283..423 157 31.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 15:54:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16712-PA 503 GM16712-PA 49..503 1..447 2207 91 Plus
Dsec\GM22231-PA 1348 GM22231-PA 813..950 283..423 163 33.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 15:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22998-PA 503 GD22998-PA 65..503 9..447 2208 93.2 Plus
Dsim\GD12202-PA 1350 GD12202-PA 815..952 283..423 163 33.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 15:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16209-PA 489 GJ16209-PA 73..488 14..447 1572 65.4 Plus
Dvir\GJ16210-PA 390 GJ16210-PA 22..379 72..430 689 40.1 Plus
Dvir\GJ10448-PA 665 GJ10448-PA 355..650 78..428 401 30.5 Plus
Dvir\GJ10448-PA 665 GJ10448-PA 518..663 82..226 347 42.6 Plus
Dvir\GJ13532-PA 1349 GJ13532-PA 815..960 283..431 166 31.4 Plus
Dvir\GJ21223-PA 321 GJ21223-PA 14..140 86..209 153 28 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 15:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21075-PA 513 GK21075-PA 66..512 9..447 1540 64.1 Plus
Dwil\GK18874-PA 427 GK18874-PA 44..392 93..435 658 38.2 Plus
Dwil\GK17237-PA 1357 GK17237-PA 855..960 299..423 156 32.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 15:54:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16549-PA 502 GE16549-PA 65..502 9..447 2113 90 Plus
Dyak\GE22947-PA 1286 GE22947-PA 425..562 283..423 162 32.4 Plus
Dyak\GE22418-PA 1348 GE22418-PA 813..950 283..423 159 32.4 Plus