Clone MIP07483 Report

Search the DGRC for MIP07483

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:74
Well:83
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG42690-RA
Protein status:MIP07483.pep: gold
Sequenced Size:616

Clone Sequence Records

MIP07483.complete Sequence

616 bp assembled on 2009-03-30

GenBank Submission: BT081359.1

> MIP07483.complete
CCGATTGAGATGTGCTGCAATGCCAACCGCCAGCTATTATGTATCTTTAC
CGGAGCATTGGCGATACTGATATCAACTTTATGTTTAGGATTCATGCTTT
ACCGGCTAGGCACGACTGGTATAAACCATTGGGAGGAGGCGTACCTGGTA
GCCTGGGCTGTCATTATTTTAGCAGCGGTACCTCTAATTGTAGGAGCAAT
AAAAGAAATTCGCTATCTTTTGGTGATTTGGATAGTAGTCGCTTTAATAA
GCGGCATTTCTCTGATAGTTATTCAAATAGAAATGTTTCATAGCTTTTTT
CATAAGGATCCTGATACAGCCTTTCATATTCTCGGTGGTATAGTCATTAT
AGTTTTCGTATTATTGCTCTGCTGTTTTCTATACTTCCCATATACGTATG
CGCGTGAGCTGGAAGGAGATTAATACGGATAAAACGGATAAAAAATATCC
AGTGTCTTGGACTTAAATTTCAAACAAAATTATCAGTTTGAAACCATTTT
TTTTTTTTGTATATTTTTAGTTGCTTAAATCAAATGTTGTTTCCTGTGGA
TATATGGGAAATACTTTAAAATAAAAATAAAAAAAAAAAAAAAAAAAACA
AAAAAAAAAAAAAAAA

MIP07483.complete Blast Records

Blast to MB8.fasta performed on 2010-07-15 21:28:17 has no hits.
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15832131..15832345 572..362 980 98.1 Minus
chr2R 21145070 chr2R 15832406..15832562 361..205 770 99.4 Minus
chr2R 21145070 chr2R 15832755..15832864 110..1 535 99.1 Minus
chr2R 21145070 chr2R 15832614..15832712 205..107 495 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:17:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG42690-RB 414 CG42690-PB 1..414 10..423 2070 100 Plus
CG42690-RA 414 CG42690-PA 1..414 10..423 2070 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:08:59 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:17:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG43195-RA 1281 CG43195-RA 189..761 1..572 2815 99.8 Plus
CG42690-RB 1286 CG42690-RB 189..761 1..572 2815 99.8 Plus
CG42690-RA 761 CG42690-RA 189..761 1..572 2815 99.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG42690-PB 137 CG42690-PB 1..137 10..420 485 100 Plus
CG42690-PA 137 CG42690-PA 1..137 10..420 485 100 Plus
CG42691-PA 140 CG42691-PA 1..139 10..426 199 47.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:17:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19944958..19945169 572..362 1010 99.5 Minus
2R 25286936 2R 19945230..19945386 361..205 785 100 Minus
2R 25286936 2R 19945580..19945689 110..1 550 100 Minus
2R 25286936 2R 19945438..19945536 205..107 495 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:45:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19946157..19946368 572..362 1020 99.5 Minus
2R 25260384 2R 19946429..19946585 361..205 785 100 Minus
2R 25260384 2R 19946779..19946888 110..1 550 100 Minus
2R 25260384 2R 19946637..19946735 205..107 495 100 Minus
Blast to na_te.dros performed 2014-11-26 20:17:35
Subject Length Description Subject Range Query Range Score Percent Strand
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 2896..2975 411..328 105 60.7 Minus

MIP07483.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:25:48 Download gff for MIP07483.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15832756..15832864 1..109 99   Minus
chr2R 15832615..15832709 110..204 100 <- Minus
chr2R 15832406..15832562 205..361 99 <- Minus
chr2R 15832131..15832345 362..572 98 <- Minus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:42:22 Download gff for MIP07483.complete
Subject Subject Range Query Range Percent Splice Strand
CG42690-RA 1..414 10..423 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:01:19 Download gff for MIP07483.complete
Subject Subject Range Query Range Percent Splice Strand
CG42690-RA 1..414 10..423 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:25:48 Download gff for MIP07483.complete
Subject Subject Range Query Range Percent Splice Strand
CG42690-RA 1..414 10..423 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:42:22 Download gff for MIP07483.complete
Subject Subject Range Query Range Percent Splice Strand
CG42690-RA 1..573 1..572 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:01:19 Download gff for MIP07483.complete
Subject Subject Range Query Range Percent Splice Strand
CG42690-RA 1..573 1..572 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:25:48 Download gff for MIP07483.complete
Subject Subject Range Query Range Percent Splice Strand
CG42690-RA 189..761 1..572 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:25:48 Download gff for MIP07483.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19945581..19945689 1..109 100   Minus
2R 19945439..19945533 110..204 100 <- Minus
2R 19945230..19945386 205..361 100 <- Minus
2R 19944958..19945169 362..572 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:01:19 Download gff for MIP07483.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15833086..15833194 1..109 100   Minus
arm_2R 15832944..15833038 110..204 100 <- Minus
arm_2R 15832735..15832891 205..361 100 <- Minus
arm_2R 15832463..15832674 362..572 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:17:06 Download gff for MIP07483.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19946780..19946888 1..109 100   Minus
2R 19946638..19946732 110..204 100 <- Minus
2R 19946429..19946585 205..361 100 <- Minus
2R 19946157..19946368 362..572 99 <- Minus

MIP07483.pep Sequence

Translation from 0 to 422

> MIP07483.pep
PIEMCCNANRQLLCIFTGALAILISTLCLGFMLYRLGTTGINHWEEAYLV
AWAVIILAAVPLIVGAIKEIRYLLVIWIVVALISGISLIVIQIEMFHSFF
HKDPDTAFHILGGIVIIVFVLLLCCFLYFPYTYARELEGD*

MIP07483.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 16:16:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG42690-PB 137 CG42690-PB 1..137 4..140 713 100 Plus
CG42690-PA 137 CG42690-PA 1..137 4..140 713 100 Plus
CG42691-PA 140 CG42691-PA 1..135 4..138 336 48.1 Plus
CG43195-PA 138 CG43195-PA 1..133 4..138 238 35.6 Plus
CG43195-PB 129 CG43195-PB 1..124 4..138 199 33.3 Plus

MIP07483.hyp Sequence

Translation from 0 to 422

> MIP07483.hyp
PIEMCCNANRQLLCIFTGALAILISTLCLGFMLYRLGTTGINHWEEAYLV
AWAVIILAAVPLIVGAIKEIRYLLVIWIVVALISGISLIVIQIEMFHSFF
HKDPDTAFHILGGIVIIVFVLLLCCFLYFPYTYARELEGD*

MIP07483.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG42690-PB 137 CG42690-PB 1..137 4..140 713 100 Plus
CG42690-PA 137 CG42690-PA 1..137 4..140 713 100 Plus
CG42691-PA 140 CG42691-PA 1..135 4..138 336 48.1 Plus
CG43195-PA 138 CG43195-PA 1..133 4..138 238 35.6 Plus
CG43195-PB 129 CG43195-PB 1..124 4..138 199 33.3 Plus