Clone MIP07504 Report

Search the DGRC for MIP07504

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:75
Well:4
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG43120-RA
Protein status:MIP07504.pep: gold
Sequenced Size:1258

Clone Sequence Records

MIP07504.complete Sequence

1258 bp assembled on 2009-03-19

GenBank Submission: BT072954.1

> MIP07504.complete
CACCATTTAACAGAGAAAATGAGCACCTCACTAAGATCCAGCCGAGGAAT
CAAGCTTATGAAGTCGGGCCATTTCTCAGATGTATGCATTCGCATAGATT
GTATTAGCTTCCGGTGCCACAAAATCATCTTAGCCTGTGCTTCTGAGTTT
TTTGAGAGATTATTTCAAGAAGATTCGGAGGAATTTTTGTTAGATGGAAC
AACCCCAGAAGTTTTTCAGATATTTCTTGATTTTATATACGCTCCTAACG
ATGACCAATTCGGCAATCTTGAACCGGATGTATTGATGTGTCTTCTGAAG
TGCGCAAATATGTGGCTCGCTGTGGAAATAGAAGAAAGATGCATCGACAT
TCTATTAGATCTATCCCCTGACATGGATCCGGATGCCCTTATTGCACTTT
TTGCAGTGTCGCATTGTGTGGATCACAAAGTATTAATGGAACAGTCTATT
GGAGTCCTGCAACATATATGGAGAAACGAAATGGACTGTCCATCAACTGT
CAGAATGGAAGTCGACTGCTTCGGAGAATATTTTAAAAACACCTCGGGAA
TGCTTTCTCCGCGTAGGCGCTTTGTCATGGTGGAAAACTGGATAAAAGGC
AATGATTTGAATAATAGACCGTGCTCTCAAAAAGATAAAATTAACCAAAT
TATTAAGAGCATTAACTTTTTGGAAATGTCATTGGAGGACTTTTACAATG
GTCCAGGAAAGTCTAACGTTTTGCCCGATTCAGACAAGTTCGAAATAATG
TATAAACTTGCCCGTTCAAATAATGAATGGACTGTTATATTGGACGAAAG
GGATCGAGATAGGTACTACATAATTGTTTTTGTGAAGAAGAAGTCGACTA
AATTTGTGTTTTATTTAAAGTTGATATAATTAACATTTTTTTATTTGTAC
CTAGTTTTCTAATTAATCCGTCAATTTTTTTTTTAATTTTTAGAAAGCCA
AAAATTCTATTATGGGAATTCCATTGGTAATACCTTTTTTTCCTTATCTT
AATTTATATTTTTCTACATATTTATGTCTTTACAACTGCGCTTTATCAGC
CCATTCTTTACTTAATGATTTGTGTTTCTACGATTGGCTTATCTACTTCC
TCTTGATTGACAGTCAATACAATAGAAATAACTTATTTTTAGATTTAATG
GGATACTTTAAGTCATTTCCTGCAGTTAAAATTGTACTGAAATCAGACAC
GTTTTGGAAATATACCACGTTTAATATATCCCCCTTCAAAAAAAAAAAAA
AAAAAAAA

MIP07504.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:27:44
Subject Length Description Subject Range Query Range Score Percent Strand
DMG6-MB6.chr3L.24.033.a 1337 DMG6-MB6.chr3L.24.033.a 103..1335 1..1233 6165 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:05:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 14372622..14373401 454..1233 3825 99.4 Plus
chr3L 24539361 chr3L 14372153..14372574 34..455 2080 99.5 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:05:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG43120-RA 861 CG43120-PA 1..861 19..879 4305 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:09:02 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:05:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG43120-RA 1270 CG43120-RA 35..1267 1..1233 6165 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:05:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG43120-PA 286 CG43120-PA 1..269 19..825 1433 100 Plus
CG11714-PC 371 CG11714-PC 31..304 106..768 246 24.5 Plus
CG11714-PD 383 CG11714-PD 43..316 106..768 246 24.5 Plus
CG11714-PA 383 CG11714-PA 43..316 106..768 246 24.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:05:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 14382517..14383296 454..1233 3900 100 Plus
3L 28110227 3L 14382048..14382469 34..455 2110 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:44:30
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 14375617..14376396 454..1233 3900 100 Plus
3L 28103327 3L 14375148..14375569 34..455 2110 100 Plus
3L 28103327 3L 14375047..14375081 1..35 175 100 Plus
Blast to na_te.dros performed on 2014-11-27 10:05:42 has no hits.

MIP07504.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:35:42 Download gff for MIP07504.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 14372622..14373404 454..1237 99   Plus
chr3L 14372155..14372572 36..453 99 -> Plus
chr3L 14372052..14372086 1..35 100 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:41:33 Download gff for MIP07504.complete
Subject Subject Range Query Range Percent Splice Strand
CG43120-RA 1..861 19..879 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:37:30 Download gff for MIP07504.complete
Subject Subject Range Query Range Percent Splice Strand
CG43120-RA 1..861 19..879 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:35:42 Download gff for MIP07504.complete
Subject Subject Range Query Range Percent Splice Strand
CG43120-RA 1..861 19..879 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:41:32 Download gff for MIP07504.complete
Subject Subject Range Query Range Percent Splice Strand
CG43120-RA 35..1267 1..1233 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:37:30 Download gff for MIP07504.complete
Subject Subject Range Query Range Percent Splice Strand
CG43120-RA 35..1270 1..1237 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:35:42 Download gff for MIP07504.complete
Subject Subject Range Query Range Percent Splice Strand
CG43120-RA 35..1270 1..1237 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:35:42 Download gff for MIP07504.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14382517..14383299 454..1237 99   Plus
3L 14382050..14382467 36..453 100 -> Plus
3L 14381947..14381981 1..35 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:37:30 Download gff for MIP07504.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 14375617..14376399 454..1237 99   Plus
arm_3L 14375150..14375567 36..453 100 -> Plus
arm_3L 14375047..14375081 1..35 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:16:06 Download gff for MIP07504.complete
Subject Subject Range Query Range Percent Splice Strand
3L 14375617..14376399 454..1237 99   Plus
3L 14375150..14375567 36..453 100 -> Plus
3L 14375047..14375081 1..35 100 -> Plus

MIP07504.pep Sequence

Translation from 0 to 878

> MIP07504.pep
HHLTEKMSTSLRSSRGIKLMKSGHFSDVCIRIDCISFRCHKIILACASEF
FERLFQEDSEEFLLDGTTPEVFQIFLDFIYAPNDDQFGNLEPDVLMCLLK
CANMWLAVEIEERCIDILLDLSPDMDPDALIALFAVSHCVDHKVLMEQSI
GVLQHIWRNEMDCPSTVRMEVDCFGEYFKNTSGMLSPRRRFVMVENWIKG
NDLNNRPCSQKDKINQIIKSINFLEMSLEDFYNGPGKSNVLPDSDKFEIM
YKLARSNNEWTVILDERDRDRYYIIVFVKKKSTKFVFYLKLI*

MIP07504.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 15:53:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24544-PA 374 GF24544-PA 1..303 7..255 261 26.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 15:53:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13879-PA 297 GG13879-PA 12..233 19..235 219 29 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 15:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG43120-PA 286 CG43120-PA 1..286 7..292 1516 100 Plus
CG11714-PC 371 CG11714-PC 31..304 36..256 246 24.5 Plus
CG11714-PD 383 CG11714-PD 43..316 36..256 246 24.5 Plus
CG11714-PA 383 CG11714-PA 43..316 36..256 246 24.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 15:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11395-PA 349 GI11395-PA 35..298 37..256 281 26.9 Plus
Dmoj\GI13916-PA 338 GI13916-PA 30..305 37..264 259 25.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 15:53:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22841-PA 310 GL22841-PA 18..294 25..254 221 25.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 15:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23885-PA 310 GA23885-PA 18..294 25..254 221 25.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 15:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24745-PA 372 GM24745-PA 43..309 36..256 251 27 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 15:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12802-PA 371 GD12802-PA 43..308 36..256 252 27.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 15:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14023-PA 317 GJ14023-PA 12..313 19..266 323 27.5 Plus
Dvir\GJ11650-PA 345 GJ11650-PA 34..290 37..256 263 28.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 15:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20210-PA 372 GE20210-PA 43..310 36..256 256 26.5 Plus
Dyak\GE21859-PA 318 GE21859-PA 10..222 18..230 255 28.4 Plus

MIP07504.hyp Sequence

Translation from 0 to 878

> MIP07504.hyp
HHLTEKMSTSLRSSRGIKLMKSGHFSDVCIRIDCISFRCHKIILACASEF
FERLFQEDSEEFLLDGTTPEVFQIFLDFIYAPNDDQFGNLEPDVLMCLLK
CANMWLAVEIEERCIDILLDLSPDMDPDALIALFAVSHCVDHKVLMEQSI
GVLQHIWRNEMDCPSTVRMEVDCFGEYFKNTSGMLSPRRRFVMVENWIKG
NDLNNRPCSQKDKINQIIKSINFLEMSLEDFYNGPGKSNVLPDSDKFEIM
YKLARSNNEWTVILDERDRDRYYIIVFVKKKSTKFVFYLKLI*

MIP07504.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG43120-PA 286 CG43120-PA 1..286 7..292 1516 100 Plus
CG11714-PC 371 CG11714-PC 31..304 36..256 246 24.5 Plus
CG11714-PD 383 CG11714-PD 43..316 36..256 246 24.5 Plus
CG11714-PA 383 CG11714-PA 43..316 36..256 246 24.5 Plus