Clone MIP08280 Report

Search the DGRC for MIP08280

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:82
Well:80
Vector:pOT2|pOTB7_DraIII
Associated Gene/Transcriptelfless-RB
Protein status:MIP08280.pep: gold
Sequenced Size:1660

Clone Sequence Records

MIP08280.complete Sequence

1660 bp assembled on 2009-03-12

GenBank Submission: BT072897.1

> MIP08280.complete
AAGCAAGGAAACGGGTTCAACTGAATTTGTAAAAAGTTGTAAGTTCCAAG
GCAGAATTCATTGGTAGTATTAAAACTGCAAAAACAGGTGCGATTTCAAA
TGGGTGATTCCAGCGACTCAGACTCTTCTACTGAATGGGAGCAGAACACT
AGGGTTATTTCCTTACCCTTTTCCAGAAACCGTTCACATTTGAGCTCTCG
CCTCAGTTACCTGGTGGGACTTCAAATGGAAAACTTCAGGACCTCGAATA
ATTCTGGAGTATCACAGCGAATCCATAACACCGGGCCCACTCCCGTACTC
GCGCCCTCCGGATTAAGATCCCGCTTACTCAGCGGTTCCTCTGAGCGGAA
TCCAAATGAGTATTACGGAGACTCGGACTCCTCAAGCAGCAGCAGATCTA
TCGACAGAACCCCATTCCTGTTGGAGTATTCCAGCGACTCAGAGTCGTCT
AGTTCCAGTGATAGTGAAAGCTCATCGACCAGCATTAGCTTCGATAGCAG
TATGAGCTCCACCGAATCATCAACACCAATGGGACATACAGAATCCTCAG
ATTCAAACGAGGATTCTCCTCCCAACAAACGGATCAAATCAGATGACGAG
GAGTCCAAGAAATCTGTCTTGCCCTACAACTGCCCTGTGTGCCTGGAAGA
TGTCCGCGAGAAGCTACCAGTGTCCACCAATTGTGGCCACGTTTTCTGCA
AAGCGTGCATTAAGAGAGCTGTCGACACTGGCAGGGTATGCCCATTGTGC
GGAGTGGATGAGCCCGAATTCCATCGTATTTTCTTGTAAGACGTGATATG
GCAGAAAGCATACTAAACTAAAAATACCACGGTTTTAAATACCACAAATA
GACTTGTGGCATATACTTTCGAAAGACCGTAACACAATATTCACACCTAA
AGAAACTGTTGCTCCATTATAACAACGCAAACAAAATCTTATCCCAGGCA
ACATACTCAAGAAACACAATGCAATCGAAAACTTTCAGCTGAGAAACTAA
AACTCAAATACAAGACAGACAACTTTGGCCATAAAACATGGCGCAAGGAC
ACACTCGCATACTTGCAGGAAACCCCGGAAAAATGGAAGGCAAGCAATGA
AAATTCCGACCTACCGCAATAAATTCCGCGGAAAAACAAAGCAAGTGATG
CCAAAATAAGAGTGAAATGGCCAGCTCACACACACACATGAATGTAAATG
AAGTGGAATCACCACCTCAGAAAAACTCAGGGACACCTCAGACACGGCCC
TGTAAATCGCGCTTATCCAAAACACAACATGGCATCAGGAGGCATTGGAG
ATTCAGTTTCATTTTCATTCAAAGATTGAATAATAGAAGGGGGTGTTCCA
TCCCTACCCCAACAACCTTTGACCTGACACAATGCTCTACATTCTATGTT
TTTGTTCGAGTTGCGCGTTCGAATCGCGACTGCGCAATAAACCTGATGCC
CCAAACAGCTGTTCTAGGCAAGACCTAGGACAACATTTGCATCCTTAACT
GGAGGCTGGCCATCCACGTTTACATTGACGTAATCCACTTGCCAGGTTGG
ATCTATTCGGTGTTGAGATATATCACAAAGCAGTTCCTTTTGTACTTTAA
TTCATTTTATTACTGAACAGCTTATAATAAAAATTCTTTATGTAAAAAAA
AAAAAAAAAA

MIP08280.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:27:01
Subject Length Description Subject Range Query Range Score Percent Strand
elfless-RB 1677 elfless-RB 35..1677 1..1643 8215 100 Plus
elfless-RC 1411 elfless-RC 35..1411 1..1377 6885 100 Plus
CG31740-RA 771 CG31740-RA 719..771 1644..1592 265 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 13:59:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18008288..18009511 1643..420 6105 99.9 Minus
chr2L 23010047 chr2L 18009906..18010120 215..1 1060 99.5 Minus
chr2L 23010047 chr2L 18009722..18009852 343..213 640 99.2 Minus
chr2L 23010047 chr2L 18009579..18009656 420..343 390 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
elfless-RC 690 CG15150-PC 1..690 100..789 3450 100 Plus
elfless-RB 690 CG15150-PB 1..690 100..789 3450 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:09:42 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:59:43
Subject Length Description Subject Range Query Range Score Percent Strand
elfless-RB 1643 CG15150-RB 1..1643 1..1643 8215 100 Plus
elfless-RC 1376 CG15150-RC 1..1376 1..1376 6880 100 Plus
CG31740-RA 606 CG31740-RA 555..606 1643..1592 260 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 13:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
elfless-PC 229 CG15150-PC 1..229 100..786 744 100 Plus
elfless-PB 229 CG15150-PB 1..229 100..786 744 100 Plus
dgrn-PD 205 CG10981-PD 127..205 550..786 182 44.4 Plus
dgrn-PB 312 CG10981-PB 234..312 550..786 182 44.4 Plus
dgrn-PA 319 CG10981-PA 241..319 550..786 182 44.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 13:59:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18009642..18010866 1644..420 6125 100 Minus
2L 23513712 2L 18011261..18011475 215..1 1075 100 Minus
2L 23513712 2L 18011077..18011207 343..213 655 100 Minus
2L 23513712 2L 18010934..18011011 420..343 390 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18009642..18010866 1644..420 6125 100 Minus
2L 23513712 2L 18011261..18011475 215..1 1075 100 Minus
2L 23513712 2L 18011077..18011207 343..213 655 100 Minus
2L 23513712 2L 18010934..18011011 420..343 390 100 Minus
Blast to na_te.dros performed on 2014-11-27 13:59:42 has no hits.

MIP08280.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 15:45:19 Download gff for MIP08280.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18009908..18010120 1..213 99   Minus
chr2L 18009723..18009851 214..342 99 <- Minus
chr2L 18009579..18009656 343..420 100 <- Minus
chr2L 18008288..18009510 421..1643 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:52:55 Download gff for MIP08280.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RA 1..564 226..789 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:40:30 Download gff for MIP08280.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RC 1..690 100..789 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:21 Download gff for MIP08280.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RB 1..690 100..789 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:45:19 Download gff for MIP08280.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RB 1..690 100..789 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-03-12 18:28:52 Download gff for MIP08280.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RA 1..1166 212..1376 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:40:30 Download gff for MIP08280.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RB 1..1643 1..1643 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:21 Download gff for MIP08280.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RB 1..1643 1..1643 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:45:19 Download gff for MIP08280.complete
Subject Subject Range Query Range Percent Splice Strand
elfless-RB 1..1643 1..1643 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 15:45:19 Download gff for MIP08280.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18011263..18011475 1..213 100   Minus
2L 18011078..18011206 214..342 100 <- Minus
2L 18010934..18011011 343..420 100 <- Minus
2L 18009643..18010865 421..1643 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:21 Download gff for MIP08280.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18011263..18011475 1..213 100   Minus
arm_2L 18011078..18011206 214..342 100 <- Minus
arm_2L 18010934..18011011 343..420 100 <- Minus
arm_2L 18009643..18010865 421..1643 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:14:49 Download gff for MIP08280.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18011263..18011475 1..213 100   Minus
2L 18011078..18011206 214..342 100 <- Minus
2L 18010934..18011011 343..420 100 <- Minus
2L 18009643..18010865 421..1643 100 <- Minus

MIP08280.pep Sequence

Translation from 99 to 788

> MIP08280.pep
MGDSSDSDSSTEWEQNTRVISLPFSRNRSHLSSRLSYLVGLQMENFRTSN
NSGVSQRIHNTGPTPVLAPSGLRSRLLSGSSERNPNEYYGDSDSSSSSRS
IDRTPFLLEYSSDSESSSSSDSESSSTSISFDSSMSSTESSTPMGHTESS
DSNEDSPPNKRIKSDDEESKKSVLPYNCPVCLEDVREKLPVSTNCGHVFC
KACIKRAVDTGRVCPLCGVDEPEFHRIFL*

MIP08280.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-26 23:46:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14677-PA 326 GF14677-PA 246..326 149..229 187 43.4 Plus
Dana\GF16357-PA 202 GF16357-PA 122..202 147..229 186 42.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-26 23:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21725-PA 192 GG21725-PA 105..192 135..229 297 60 Plus
Dere\GG13065-PA 320 GG13065-PA 242..320 151..229 163 42 Plus
Dere\GG22477-PA 94 GG22477-PA 38..80 175..217 135 51.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-26 23:46:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22295-PA 202 GH22295-PA 146..202 175..229 158 49.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 23:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
elfless-PC 229 CG15150-PC 1..229 1..229 1186 100 Plus
elfless-PB 229 CG15150-PB 1..229 1..229 1186 100 Plus
dgrn-PD 205 CG10981-PD 42..205 42..229 183 30.7 Plus
dgrn-PB 312 CG10981-PB 149..312 42..229 183 30.7 Plus
dgrn-PA 319 CG10981-PA 156..319 42..229 183 30.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-26 23:46:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14783-PA 374 GI14783-PA 319..360 176..217 163 59.5 Plus
Dmoj\GI21991-PA 294 GI21991-PA 239..294 176..229 161 51.8 Plus
Dmoj\GI13656-PA 254 GI13656-PA 198..254 175..229 156 49.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-26 23:46:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24328-PA 317 GL24328-PA 245..317 156..229 150 42.1 Plus
Dper\GL24317-PA 151 GL24317-PA 82..137 160..217 144 44.8 Plus
Dper\GL20345-PA 117 GL20345-PA 62..107 176..221 137 45.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-26 23:46:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25529-PA 128 GA25529-PA 9..128 112..229 173 35.5 Plus
Dpse\GA26569-PA 209 GA26569-PA 140..195 160..217 158 46.6 Plus
Dpse\GA28705-PA 209 GA28705-PA 140..195 160..217 152 44.8 Plus
Dpse\GA28704-PA 209 GA28704-PA 140..195 160..217 152 44.8 Plus
Dpse\GA28682-PA 138 GA28682-PA 69..124 160..217 150 44.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-26 23:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10845-PA 329 GM10845-PA 256..329 156..229 174 47.4 Plus
Dsec\GM20261-PA 167 GM20261-PA 45..87 175..217 155 51.2 Plus
Dsec\GM17105-PA 97 GM17105-PA 9..62 50..108 152 59.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-26 23:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17803-PA 157 GD17803-PA 4..64 39..107 179 59.4 Plus
Dsim\GD19827-PA 329 GD19827-PA 256..329 156..229 174 47.4 Plus
Dsim\GD25747-PA 101 GD25747-PA 45..101 175..229 157 45.6 Plus
Dsim\GD22545-PA 91 GD22545-PA 21..91 152..229 137 35.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-26 23:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13990-PA 303 GJ13990-PA 227..303 155..229 161 40.3 Plus
Dvir\GJ18825-PA 288 GJ18825-PA 233..284 176..228 156 54.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-26 23:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14441-PA 207 GK14441-PA 152..207 176..229 158 46.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-26 23:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13114-PA 239 GE13114-PA 25..239 23..229 364 50.4 Plus
Dyak\GE10170-PA 344 GE10170-PA 268..344 154..229 173 42.3 Plus
Dyak\GE13346-PA 230 GE13346-PA 174..230 175..229 147 45.6 Plus

MIP08280.hyp Sequence

Translation from 99 to 788

> MIP08280.hyp
MGDSSDSDSSTEWEQNTRVISLPFSRNRSHLSSRLSYLVGLQMENFRTSN
NSGVSQRIHNTGPTPVLAPSGLRSRLLSGSSERNPNEYYGDSDSSSSSRS
IDRTPFLLEYSSDSESSSSSDSESSSTSISFDSSMSSTESSTPMGHTESS
DSNEDSPPNKRIKSDDEESKKSVLPYNCPVCLEDVREKLPVSTNCGHVFC
KACIKRAVDTGRVCPLCGVDEPEFHRIFL*

MIP08280.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
elfless-PC 229 CG15150-PC 1..229 1..229 1186 100 Plus
elfless-PB 229 CG15150-PB 1..229 1..229 1186 100 Plus
dgrn-PD 205 CG10981-PD 42..205 42..229 183 30.7 Plus
dgrn-PB 312 CG10981-PB 149..312 42..229 183 30.7 Plus
dgrn-PA 319 CG10981-PA 156..319 42..229 183 30.7 Plus