Clone MIP10102 Report

Search the DGRC for MIP10102

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:101
Well:2
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG1077-RA
Protein status:MIP10102.pep: gold
Sequenced Size:2333

Clone Sequence Records

MIP10102.complete Sequence

2333 bp assembled on 2009-07-24

GenBank Submission: BT088952.1

> MIP10102.complete
ATTGAGTTTCGGAACTGACTCAGAACTGCAAGAACATGGCCGGGAGAAGG
GTGATTGGTCTCTGTTTTGGAATATTCTTACAAGTGCTGCTAGCGACTGC
TGGACAGGATCGGATGAGCATGCTCTGTTCCGACGACGACACACCAGCCT
GTGCCCAGAGCCGCGAAAATGGAATGTACTTTTTGTTCGCCAACGAGTGT
GACCTTCGGAAGGCCCAGCGTGGCAACCTCATGAATGGCCCTCTATATGA
CGTTACGCTTCGATTCTGCTTTCCCAGCTGCGAATTCGAGTGCAGCTCAA
GATATCAGCCAGTTTGTGGCATCAGCTCGAAGTCGGGGGAACGAAAGACC
TTCAGGAGTCGCTGCGAAATGCTGCGAACCGCTTGCATCTCAAGGTCGGA
GTGGATGGTCCATCGATGGGGAGTGTGTCCAAAAGCCAACGCGGTGCCAC
AGATCAGTGAAAAGCCGCCTGTGCCCGTGCCCTGCACCAGGATCTATCGA
CCTGTTTGCGCCATGTACGCTGGTGTCAAGTCAACCTTCTCCAACGAGTG
TTTGGTGAACGCGGAAAACATCAAGTCCCAGAGAAACTGGCGCATCGTTT
CCGAGGGCCTTTGTGGCGAGGACAGCACCAAGATGAAGCATAGTCGCAAG
CAGAAGCCGAAGGCCAAGCCCAAGTCGGATGCGGAGCGCACCAAGCGGAG
CCACAGAGGCAAGAGGCTGTCCACTCAGGCGGAAGACTTCCAGATACCGG
AGGACGCCGTGGAGATTTACGCTCCCTCGACCTTTCACACGCAGTTCATC
AGCCAATCGGGCGCCATGGAGAAGAGCTACTCTCTGCCCGCCAGGAAGCC
CTATGTGGTGGTCCCGCCTAAATCGAAGCGGCGAATCCCCACAAAGTCTT
GTGTTTTCGGCAATGAGCCTGTTTGCGGGAACTTAAGAGGGCAGAGTCGC
ACCTTTTCCAACGTTTGTGAACTCATGGAGTTTAGCCAAAAAGTCGGAAA
TGCATGGACCATTGCTCACAATGGAGCCTGTCGCCGCTGCGATAAGACTT
GTCCTACGGTTTATCAACCTATTTGTGCCACCAGAAACGGCATCAATCAC
ACAATCGTCAACGAGTGCTATTTGGAGCGAGTGCGCTGCAAGGATCCAAA
AAGCATATGGAAGCTATCCCACAAAGGTGAGTGCGCCAAGTCAGTGAGCA
ACCCACGGCACATTTACTCCACTGGTAAAAGTCGCCCAACGTCTTTGGTG
CCAAGTGTTTTATACGGAAAGAGCACCACCACACCACGAAGTCGCTTCAG
GAAACCAGTACGTAGGTTCACAACCACAAGGACTCCAACCACACCATACA
AGCCACGTCAGCTGGCGATGACAAATTTCTCGGCCACTTCGCCTTCCCTG
GAAACCAATAATCGCAAAATACGCAAAATTGAGCTCGCTGCTGCGGGATT
TTCGGGCTTGGGTGCGTCAAGCGGGTCAAATTTTCTGAGCTCTGAGGAAG
ATGCTTTCTGGTCCTCTGATGACAGTTGGCTGGTGCAGAAAACTCTCGAT
AATGTCAAGGGCTTGCTTGGCAATAAGCCTACTTCCTTGAAGAAGGAGCA
CGGTGAGAAGTACCCACTGTCCTATTGGATTGTCCCACCAAGGCAAACAA
GTACTATCAGCACCACCACAGCTGCACCACCAGCTAAACTACCAGCTATT
CTCAGCATGGCATCCACGGAGCTATTAAATTTGGATTTTGGAAACCCTTC
CAGCGCTTACGAAGAAGCTGATCACGAAGCGATGCTCATGCTGACCACTA
AAGAGGGCACCACCTCAACCACACCTGTGCCCAGCACCACTACACCGCCC
AACATCACCGAACCTTCTACTACTGAATTGCCCACCAGTGTTGACGTTGC
CTCTGACTCGGCGGAAACGGTCAGTGAAGACTCCACGACGGATTTCGGAG
AAACGACTGATCCAACGACCAGCAACGATTCCAGCACCTCAGATGCACCA
CAATCTTCGACCACAGAGGCCGAGGAGTTGAACAGCCAAACCACCGGGAG
CGAGTCCACCACCACCGTGGCCTCCGACAAGCTGTCTACGACCACTTTAA
ATGCCGACTACGCGGTGGATGAGTCATTTTCCGAGTCCAGTGGTCAGACC
TCCATCTATGGGCTCGACAAGAACTCCTTGATCATGAGGTTGCTACGTGC
CAGAAGTAACCAAAACGTGCTCATCTAGTTCTAGTAACTCTGTTAAACAT
AGATTTAGGTTGTTGATTTCTCACGTTTCCAATAAATACAAGACTTAAAT
ATTCAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP10102.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:31:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG1077-RA 2422 CG1077-RA 97..2403 1..2307 11520 99.9 Plus
CG1077.a 2695 CG1077.a 393..2694 1..2302 11510 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:20:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1994818..1995964 1156..2302 5735 100 Plus
chr3R 27901430 chr3R 1994023..1994439 586..1002 2085 100 Plus
chr3R 27901430 chr3R 1993539..1993877 247..585 1695 100 Plus
chr3R 27901430 chr3R 1993138..1993387 1..250 1220 99.2 Plus
chr3R 27901430 chr3R 1994610..1994763 1002..1155 770 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:20:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG1077-RA 2193 CG1077-PA 1..2193 36..2228 10965 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:12:02 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG1077-RA 2302 CG1077-RA 1..2302 1..2302 11510 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:20:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG1077-PA 730 CG1077-PA 1..730 36..2225 3265 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6169163..6170314 1156..2307 5745 99.9 Plus
3R 32079331 3R 6168368..6168784 586..1002 2085 100 Plus
3R 32079331 3R 6167884..6168222 247..585 1695 100 Plus
3R 32079331 3R 6167483..6167732 1..250 1235 99.6 Plus
3R 32079331 3R 6168955..6169108 1002..1155 770 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:27:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5909994..5911145 1156..2307 5745 99.9 Plus
3R 31820162 3R 5909199..5909615 586..1002 2085 100 Plus
3R 31820162 3R 5908715..5909053 247..585 1695 100 Plus
3R 31820162 3R 5908314..5908563 1..250 1235 99.6 Plus
3R 31820162 3R 5909786..5909939 1002..1155 770 100 Plus
Blast to na_te.dros performed on 2014-11-26 20:20:09 has no hits.

MIP10102.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:26:43 Download gff for MIP10102.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1994818..1995966 1156..2304 99   Plus
chr3R 1994611..1994763 1003..1155 100 -> Plus
chr3R 1994023..1994439 586..1002 100 -> Plus
chr3R 1993539..1993877 247..585 100 -> Plus
chr3R 1993138..1993383 1..246 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:49 Download gff for MIP10102.complete
Subject Subject Range Query Range Percent Splice Strand
CG1077-RA 1..2193 36..2228 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:00:11 Download gff for MIP10102.complete
Subject Subject Range Query Range Percent Splice Strand
CG1077-RA 1..2193 36..2228 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:02:14 Download gff for MIP10102.complete
Subject Subject Range Query Range Percent Splice Strand
CG1077-RA 1..2193 36..2228 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:26:43 Download gff for MIP10102.complete
Subject Subject Range Query Range Percent Splice Strand
CG1077-RA 1..2193 36..2228 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-07-24 16:29:34 Download gff for MIP10102.complete
Subject Subject Range Query Range Percent Splice Strand
CG1077-RA 1..2268 36..2303 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:00:11 Download gff for MIP10102.complete
Subject Subject Range Query Range Percent Splice Strand
CG1077-RA 1..2268 36..2303 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:02:14 Download gff for MIP10102.complete
Subject Subject Range Query Range Percent Splice Strand
CG1077-RA 1..2302 1..2302 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:26:43 Download gff for MIP10102.complete
Subject Subject Range Query Range Percent Splice Strand
CG1077-RA 1..2302 1..2302 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:26:43 Download gff for MIP10102.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6169163..6170311 1156..2304 99   Plus
3R 6168956..6169108 1003..1155 100 -> Plus
3R 6168368..6168784 586..1002 100 -> Plus
3R 6167884..6168222 247..585 100 -> Plus
3R 6167483..6167728 1..246 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:02:14 Download gff for MIP10102.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1994885..1996033 1156..2304 99   Plus
arm_3R 1994678..1994830 1003..1155 100 -> Plus
arm_3R 1994090..1994506 586..1002 100 -> Plus
arm_3R 1993606..1993944 247..585 100 -> Plus
arm_3R 1993205..1993450 1..246 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:51:55 Download gff for MIP10102.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5909994..5911142 1156..2304 99   Plus
3R 5909787..5909939 1003..1155 100 -> Plus
3R 5909199..5909615 586..1002 100 -> Plus
3R 5908715..5909053 247..585 100 -> Plus
3R 5908314..5908559 1..246 100 -> Plus

MIP10102.pep Sequence

Translation from 35 to 2227

> MIP10102.pep
MAGRRVIGLCFGIFLQVLLATAGQDRMSMLCSDDDTPACAQSRENGMYFL
FANECDLRKAQRGNLMNGPLYDVTLRFCFPSCEFECSSRYQPVCGISSKS
GERKTFRSRCEMLRTACISRSEWMVHRWGVCPKANAVPQISEKPPVPVPC
TRIYRPVCAMYAGVKSTFSNECLVNAENIKSQRNWRIVSEGLCGEDSTKM
KHSRKQKPKAKPKSDAERTKRSHRGKRLSTQAEDFQIPEDAVEIYAPSTF
HTQFISQSGAMEKSYSLPARKPYVVVPPKSKRRIPTKSCVFGNEPVCGNL
RGQSRTFSNVCELMEFSQKVGNAWTIAHNGACRRCDKTCPTVYQPICATR
NGINHTIVNECYLERVRCKDPKSIWKLSHKGECAKSVSNPRHIYSTGKSR
PTSLVPSVLYGKSTTTPRSRFRKPVRRFTTTRTPTTPYKPRQLAMTNFSA
TSPSLETNNRKIRKIELAAAGFSGLGASSGSNFLSSEEDAFWSSDDSWLV
QKTLDNVKGLLGNKPTSLKKEHGEKYPLSYWIVPPRQTSTISTTTAAPPA
KLPAILSMASTELLNLDFGNPSSAYEEADHEAMLMLTTKEGTTSTTPVPS
TTTPPNITEPSTTELPTSVDVASDSAETVSEDSTTDFGETTDPTTSNDSS
TSDAPQSSTTEAEELNSQTTGSESTTTVASDKLSTTTLNADYAVDESFSE
SSGQTSIYGLDKNSLIMRLLRARSNQNVLI*

MIP10102.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:09:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16370-PA 750 GF16370-PA 1..750 1..730 2178 59.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:09:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13119-PA 742 GG13119-PA 1..742 1..730 3114 81.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:10:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14014-PA 579 GH14014-PA 9..404 12..373 1241 57.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:09:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG1077-PA 730 CG1077-PA 1..730 1..730 3836 100 Plus
Mur11Da-PD 626 CG32644-PD 192..462 410..706 179 25.5 Plus
CG46026-PA 666 CG46026-PA 349..650 386..707 162 24.8 Plus
Muc68D-PB 1514 CG6004-PB 545..847 395..705 160 23.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:10:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24385-PA 808 GI24385-PA 29..808 25..730 1571 45.6 Plus
Dmoj\GI16285-PA 1174 GI16285-PA 35..130 289..384 168 34.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:10:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24047-PA 755 GL24047-PA 1..755 1..730 2047 54.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:10:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10553-PA 755 GA10553-PA 1..755 1..730 2027 54 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:10:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10857-PA 733 GM10857-PA 1..733 1..730 3330 93.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:10:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19840-PA 747 GD19840-PA 1..747 1..730 3426 92.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:10:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14240-PA 788 GJ14240-PA 31..616 25..586 1315 47.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:10:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13027-PA 695 GK13027-PA 1..695 1..730 1647 49 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10181-PA 729 GE10181-PA 1..729 1..730 3163 85.1 Plus

MIP10102.hyp Sequence

Translation from 35 to 2227

> MIP10102.hyp
MAGRRVIGLCFGIFLQVLLATAGQDRMSMLCSDDDTPACAQSRENGMYFL
FANECDLRKAQRGNLMNGPLYDVTLRFCFPSCEFECSSRYQPVCGISSKS
GERKTFRSRCEMLRTACISRSEWMVHRWGVCPKANAVPQISEKPPVPVPC
TRIYRPVCAMYAGVKSTFSNECLVNAENIKSQRNWRIVSEGLCGEDSTKM
KHSRKQKPKAKPKSDAERTKRSHRGKRLSTQAEDFQIPEDAVEIYAPSTF
HTQFISQSGAMEKSYSLPARKPYVVVPPKSKRRIPTKSCVFGNEPVCGNL
RGQSRTFSNVCELMEFSQKVGNAWTIAHNGACRRCDKTCPTVYQPICATR
NGINHTIVNECYLERVRCKDPKSIWKLSHKGECAKSVSNPRHIYSTGKSR
PTSLVPSVLYGKSTTTPRSRFRKPVRRFTTTRTPTTPYKPRQLAMTNFSA
TSPSLETNNRKIRKIELAAAGFSGLGASSGSNFLSSEEDAFWSSDDSWLV
QKTLDNVKGLLGNKPTSLKKEHGEKYPLSYWIVPPRQTSTISTTTAAPPA
KLPAILSMASTELLNLDFGNPSSAYEEADHEAMLMLTTKEGTTSTTPVPS
TTTPPNITEPSTTELPTSVDVASDSAETVSEDSTTDFGETTDPTTSNDSS
TSDAPQSSTTEAEELNSQTTGSESTTTVASDKLSTTTLNADYAVDESFSE
SSGQTSIYGLDKNSLIMRLLRARSNQNVLI*

MIP10102.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:42:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG1077-PA 730 CG1077-PA 1..730 1..730 3836 100 Plus
Mur11Da-PD 626 CG32644-PD 192..462 410..706 179 25.5 Plus
CG46026-PA 666 CG46026-PA 349..650 386..707 162 24.8 Plus
Muc68D-PB 1514 CG6004-PB 545..847 395..705 160 23.7 Plus