Clone MIP10106 Report

Search the DGRC for MIP10106

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:101
Well:6
Vector:pOTB7_DraIII
Associated Gene/Transcriptgudu-RA
Protein status:MIP10106.pep: gold
Sequenced Size:2251

Clone Sequence Records

MIP10106.complete Sequence

2251 bp assembled on 2009-06-09

GenBank Submission: BT088789.1

> MIP10106.complete
AAATCAATTGCCTGGCCTAATAAAGTTCTCCCACACAAAAACACAATAAA
TTCCGATACAAAACTGAAGAAAGCTGGCATACCGACAGATATTTCCGGAA
TACGATTGGCCAAATCTGTGAGTAATCCAACGCGAAAGGATGATTGGCAC
TAGCAGCGGAACGTCCCACAATCGGAGTCGAAAGAAGAAAGAACAGTGCG
GATCCTGTCCCAACAGATTCTCAAAGGATAAGCGCCAGGTGGCCGCCGAG
GACTCGGATACCACGGAGGTGGAATCGTCTACGGATGAGGAGGAACGCTG
GAAGGAAGTGGCGCGAGCCGCTGAGATTCCGGCTGACTATTATAATATCC
AAAAACTGGTGAAATACATCAAGGCGGGCAATCAGACAGCCACTATAGTA
TCGTTGTGCTGCTTGAAGGACTACGATCTGAGCACCCAGATCAATCAGTT
CGCCATCTCGGACATCGGCGGACTCGATGTCTTGGTTAACATCCTGGAGT
GCAGCGACACCAAGTGCTGTTTGGGCGCCCTCAAAGTTCTCTCAGATATC
ACACTGAACATCGATATTAGGAAGACCATCGTAGATCTGGATGGCATTCC
CCTCATTGTGGACATCCTAAACTCTTCCATGAAGGACCTAAAAACCATGG
CCGCCGAGACATTGGCCAATGTGTGCAAGGTGCGACTGGCCAGAAAGTAT
GTGCGCACCTGCGGAGGAATCCCCAAGCTGGTGGATCTCATCGACATCAA
GTTGAGCATTCTAAAGACGCCTCGTGACCAATTGAGTCCAGATGATCTGG
AATCTCTCGATATGACACGCGCTGGAGCCCGGGCTCTTTTCACTCTGGCC
GATTCCAAGCACAACATGGAGCAGATGCGCAAGAGCGGAATTGTTCCTTT
GATGGCTCAGCTCCTTAAGTCCTGTCACATCGATGTCGTCATTCCCATAA
TGGGCACCGTTCGAAAGTGCTCCTCGGAGCCGAAGTTCCAACTGGCCATC
ACCACCGAGGGCATGATTCCCGACATTGTGAGCCATCTGAGTTCCGAAAA
TACCGAGCTGAAGATGGAGGGCAGTACAGCGATCTACAAGTGCGCCTTCG
ACGGAACCACCAGGGATTTGGTGAGGGAGGCTGGGGGCTTGGAACCTTTG
GTAACTATCATAAAGGACAAGAATGTGAGGGAAAATAAGCCTTTATTGAG
AGGCGCCACTGGAGCGATTTGGATGTGTGCCGTAACCGATGCAAATGTCA
AAGTGCTGGATCAACTCAGGACGGTGAACCACCTGGTGGCCTTGCTAAAT
GATGAGTGTGACGAGGTCCTGACCAACGTGACCGGAGCTATATCTGAATG
TGTGAGATTTCAAAGCAATAGGGAGCAACTGCGTCAGGCTGGAGGATTAC
CAGCAATGGTTTCCCTACTCAACAGTTCTCACGCCCCTCTTCTGGAAAAT
TTAGCCAAGGGATTGAAGGAGTGTGCCGAAGATCCGGACAGCATGAGAAT
CCTTGAGGATCTGGATGCGGTCAGGCTGATATGGTCGCTATTGAAGAACC
CCACAACTAGGGTTCAGGCCCATGCGGCTTACGCCATATGTCCCTGTGTT
CGAAATGCCAACGATTCCGCTGAATTGGTCAGGAGCTTGGTTGGCGCCAT
GGAACTGGTGGTGGGTCTGCTAAAGTCCAAGGATATCATGGTCTTATCCG
CCGTTTGTGCTGCCATTGCAACAATTGCCCAGGATCAAACCAATCTAGCC
ATCTTAACCGATCTGAAAGTCATCTACAAGCTAGCCGATCTCGTCCAGAC
CACCGACGACCTCCTTCGAATGAACTTGGCAGCTGCCGTGGCCGCCTGTG
CCTGCTTCGGTAATAATACGGAGGAACTGGGACGTCTGCGTACTGTCACT
CCGATTGTCACCTACATGACCAGCGACAATCCCTTGGTGCACCGCAGCAC
GGCCATGGCACTGGAGAAGCTATCGATGGATCCGCAGAACTGCATTACCA
TGCACCAGAGTGGAGTTGTTCCTTTCCTGCTGGAGTGCATTGGATCCACT
AACAAGGAGCTCCAGTTGGCCGCCGCTGGTTGTCTGCGCAATATCCGCGA
ATTGGCCTTGCGTGCCGAGGAATATCTGCTTAAAATCGACGATGACTAGC
TTCCTGTTTTTTTTTTCTTTGTTAAGTTATTTAATTGTATTTGACGAAAT
ATATGTGTGTATGCCGATGCTATCAAAAAAAAAAAAAAAAAAAAAAAAAA
A

MIP10106.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG5155-RA 2268 CG5155-RA 30..2254 1..2226 11075 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 10:24:43
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7388408..7389661 755..2008 6195 99.6 Plus
chr2L 23010047 chr2L 7387572..7388327 1..756 3720 99.5 Plus
chr2L 23010047 chr2L 7389720..7389934 2006..2222 1020 99.1 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:24:39
Subject Length Description Subject Range Query Range Score Percent Strand
gudu-RA 2010 CG5155-PA 1..2010 140..2149 10050 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:12:03 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:24:38
Subject Length Description Subject Range Query Range Score Percent Strand
gudu-RA 2252 CG5155-RA 30..2250 1..2222 11060 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 10:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
gudu-PA 669 CG5155-PA 1..669 140..2146 3165 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 10:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7389373..7390626 755..2008 6270 100 Plus
2L 23513712 2L 7388537..7389292 1..756 3780 100 Plus
2L 23513712 2L 7390685..7390904 2006..2226 1040 99.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:58
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7389373..7390626 755..2008 6270 100 Plus
2L 23513712 2L 7388537..7389292 1..756 3780 100 Plus
2L 23513712 2L 7390685..7390904 2006..2226 1050 99 Plus
Blast to na_te.dros performed on 2014-11-27 10:24:37 has no hits.

MIP10106.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:42:36 Download gff for MIP10106.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7389723..7389935 2009..2224 98   Plus
chr2L 7388410..7389661 757..2008 99 -> Plus
chr2L 7387572..7388327 1..756 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:15 Download gff for MIP10106.complete
Subject Subject Range Query Range Percent Splice Strand
CG5155-RA 1..2010 140..2149 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:47:15 Download gff for MIP10106.complete
Subject Subject Range Query Range Percent Splice Strand
CG5155-RA 1..2010 140..2149 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:41:49 Download gff for MIP10106.complete
Subject Subject Range Query Range Percent Splice Strand
CG5155-RA 1..2010 140..2149 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:42:36 Download gff for MIP10106.complete
Subject Subject Range Query Range Percent Splice Strand
gudu-RA 1..2010 140..2149 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-09 09:54:31 Download gff for MIP10106.complete
Subject Subject Range Query Range Percent Splice Strand
CG5155-RA 1..2080 140..2220 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:47:15 Download gff for MIP10106.complete
Subject Subject Range Query Range Percent Splice Strand
CG5155-RA 1..2222 1..2224 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:41:49 Download gff for MIP10106.complete
Subject Subject Range Query Range Percent Splice Strand
CG5155-RA 30..2251 1..2224 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:42:36 Download gff for MIP10106.complete
Subject Subject Range Query Range Percent Splice Strand
gudu-RA 30..2251 1..2224 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:42:36 Download gff for MIP10106.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7390688..7390901 2009..2224 99   Plus
2L 7389375..7390626 757..2008 100 -> Plus
2L 7388537..7389292 1..756 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:41:49 Download gff for MIP10106.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7390688..7390901 2009..2224 99   Plus
arm_2L 7389375..7390626 757..2008 100 -> Plus
arm_2L 7388537..7389292 1..756 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:22:42 Download gff for MIP10106.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7390688..7390901 2009..2224 99   Plus
2L 7389375..7390626 757..2008 100 -> Plus
2L 7388537..7389292 1..756 100 -> Plus

MIP10106.pep Sequence

Translation from 139 to 2148

> MIP10106.pep
MIGTSSGTSHNRSRKKKEQCGSCPNRFSKDKRQVAAEDSDTTEVESSTDE
EERWKEVARAAEIPADYYNIQKLVKYIKAGNQTATIVSLCCLKDYDLSTQ
INQFAISDIGGLDVLVNILECSDTKCCLGALKVLSDITLNIDIRKTIVDL
DGIPLIVDILNSSMKDLKTMAAETLANVCKVRLARKYVRTCGGIPKLVDL
IDIKLSILKTPRDQLSPDDLESLDMTRAGARALFTLADSKHNMEQMRKSG
IVPLMAQLLKSCHIDVVIPIMGTVRKCSSEPKFQLAITTEGMIPDIVSHL
SSENTELKMEGSTAIYKCAFDGTTRDLVREAGGLEPLVTIIKDKNVRENK
PLLRGATGAIWMCAVTDANVKVLDQLRTVNHLVALLNDECDEVLTNVTGA
ISECVRFQSNREQLRQAGGLPAMVSLLNSSHAPLLENLAKGLKECAEDPD
SMRILEDLDAVRLIWSLLKNPTTRVQAHAAYAICPCVRNANDSAELVRSL
VGAMELVVGLLKSKDIMVLSAVCAAIATIAQDQTNLAILTDLKVIYKLAD
LVQTTDDLLRMNLAAAVAACACFGNNTEELGRLRTVTPIVTYMTSDNPLV
HRSTAMALEKLSMDPQNCITMHQSGVVPFLLECIGSTNKELQLAAAGCLR
NIRELALRAEEYLLKIDDD*

MIP10106.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:37:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15856-PA 666 GF15856-PA 7..666 10..669 3270 95.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10473-PA 669 GG10473-PA 1..669 1..669 3405 97.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:37:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13729-PA 666 GH13729-PA 9..666 12..669 2877 86 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:37:09
Subject Length Description Subject Range Query Range Score Percent Strand
gudu-PA 669 CG5155-PA 1..669 1..669 3383 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:37:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23708-PA 666 GI23708-PA 1..666 1..669 2890 85.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:37:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25813-PA 668 GL25813-PA 1..668 1..669 3155 91.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:37:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18696-PA 668 GA18696-PA 1..668 1..669 3155 91.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:37:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16402-PA 669 GM16402-PA 1..669 1..669 3479 98.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:37:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23466-PA 669 GD23466-PA 1..669 1..669 3486 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:37:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20904-PA 666 GJ20904-PA 1..666 1..669 2928 86.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:37:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24302-PA 667 GK24302-PA 1..667 1..669 3135 89.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:37:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14502-PA 669 GE14502-PA 1..669 1..669 3413 97.9 Plus

MIP10106.hyp Sequence

Translation from 139 to 2148

> MIP10106.hyp
MIGTSSGTSHNRSRKKKEQCGSCPNRFSKDKRQVAAEDSDTTEVESSTDE
EERWKEVARAAEIPADYYNIQKLVKYIKAGNQTATIVSLCCLKDYDLSTQ
INQFAISDIGGLDVLVNILECSDTKCCLGALKVLSDITLNIDIRKTIVDL
DGIPLIVDILNSSMKDLKTMAAETLANVCKVRLARKYVRTCGGIPKLVDL
IDIKLSILKTPRDQLSPDDLESLDMTRAGARALFTLADSKHNMEQMRKSG
IVPLMAQLLKSCHIDVVIPIMGTVRKCSSEPKFQLAITTEGMIPDIVSHL
SSENTELKMEGSTAIYKCAFDGTTRDLVREAGGLEPLVTIIKDKNVRENK
PLLRGATGAIWMCAVTDANVKVLDQLRTVNHLVALLNDECDEVLTNVTGA
ISECVRFQSNREQLRQAGGLPAMVSLLNSSHAPLLENLAKGLKECAEDPD
SMRILEDLDAVRLIWSLLKNPTTRVQAHAAYAICPCVRNANDSAELVRSL
VGAMELVVGLLKSKDIMVLSAVCAAIATIAQDQTNLAILTDLKVIYKLAD
LVQTTDDLLRMNLAAAVAACACFGNNTEELGRLRTVTPIVTYMTSDNPLV
HRSTAMALEKLSMDPQNCITMHQSGVVPFLLECIGSTNKELQLAAAGCLR
NIRELALRAEEYLLKIDDD*

MIP10106.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
gudu-PA 669 CG5155-PA 1..669 1..669 3383 100 Plus