Clone MIP10156 Report

Search the DGRC for MIP10156

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:101
Well:56
Vector:pOTB7_DraIII
Associated Gene/TranscriptRIOK2-RA
Protein status:MIP10156.pep: gold
Sequenced Size:1773

Clone Sequence Records

MIP10156.complete Sequence

1773 bp assembled on 2009-05-20

GenBank Submission: BT083465.1

> MIP10156.complete
GCCTGCACGTGTGAAACGAAAACATTGCTAAATGCGTTGTTAAACTGTCA
AAATAGAACGAAAATGGGTAAATTAAACGTGACAGTGCTGCGATATCTCA
CCAAAGAGGACTTCCGCGTCCTCACCGCCATCGAGATGGGCATGAAGAAC
CACGAGCTGGTCCCTGGTCCCCTGGCTGCTGCCATTGCGAATCTGAAGTC
GGGTGGAGTCCACAAGCTGCTCAAGGAGCTGTGCAAGCACAAGCTATTGG
CCTACGAACGGGGAAAGAAATATGATGGCTACCGCTTGACAAACACGGGC
TACGACTATCTGGCTCTGAAGTCTCTCACACTGCGGGGATCGGTCAGTTC
CTTTGGCAACCAGATTGGAATTGGCAAGGAGTCCAACATCTACGTGGTGG
CTGATGAGGAGGGCACTCCAATTTGCCTCAAACTACACCGATTGGGTCGA
ACTTGTTTCAGGAATGTAAAAGCCAAAAGAGACTACCACGGTCGCCGACA
CAAGGCCTCCTGGTTGTACTTATCTCGCATCTCGGCTACCCGCGAGTTTG
CCTACATGTCGGCACTCTATGATCGTGGGTTTCCAGTGCCAAAACCCATC
GATTTCAACCGCCACTGCGTCTTAATGGACCTCGTCAAGGGCTGGCCCAT
GACCCAAGTTCACGAACTTCTAGACGCTCCACAAGTTTACGATGATCTTA
TGAACCTTATTGTGCGTCTGGGAAATTCTGGAGTTATTCATGGCGATTTT
AATGAGTTTAATTTAATGGTGACAGACGCCGGCAAGCCCATACTGATTGA
TTTCCCTCAGATGATGTCCACCTCGCATGAAAATGCAGAATTTTTCTTCG
AACGCGATGTTAACTGCGTGCGTGAAATGTTCCGTCGCAAATTTGGTTAC
GAAAGCGAAGACTACCCCAAGTTCAGCGACCTGGTGCGTGAGGATGATTT
GGATGCCGAGGTACATTGCACAGGCTATGGCTTCACTAAGGAGATGGAGC
AGGATCTTCTTGAGGAGTACGGCATGGTGGATCAGGCAGATGAGGAGGAT
GAGGGAGAGGATTTGGAAGAGGAGGAAGAGCCTCCCACCTTGGTTACCGC
AGCATCTGTAGAGATTGACGAGTGCCGACGCCAGGTGGAGAACGAAGTCA
TTTATAGCGAAGCCAAGCCCACTCAGAAGTCGGATGACGCAGTGCGTCGG
TACATTGAATCGTGTACGCAATATCTGGGTAATCTCAGCGTAGGTCCAGA
AGTTCCCGATCAAACAATGCCCAAAAAGTTGGACATTTCCCTGCCGGCTG
AAACTCCAGACGTTATTCCATTCGAAGCTGAAACTTCGGCAACTAATACC
GTTGAAGAAGACGTCAAGTCCATCAGTTCCAATGATTTAGATACGGATGA
AGTTCCCGAGCTAGTTGGCCTGGATCCTAACTCCCGCATGTATCGTCTCA
AAATGGTCGAGCAAATGCTAAATGATGCGAGAAGTCAACGCTCCTATTCT
ACCACAACCAGCACAATAGCTCCGTCTGTGATTACCGACCGGATACGACG
CAACATGGACATTAAGGAGAAGCGGGAGCAGCGAAAGAAGTGTGTGGCCA
AGGGAGAGGCTAGTGCTGTGCATCGTCATCGCAAGGAGAACAAGGATGTG
GTTAAGGAGTATGCTGGCTGGGACTTCTAGATCATGTTAATCTATTAAAT
AAAAATAGTGATATGTATATTTAAAATTAAAACATTTCATCAAGACATCG
CGAAAAAAAAAAAAAAAAAAAAA

MIP10156.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:30:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG11859-RA 1866 CG11859-RA 39..1789 1..1751 8755 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21089932..21090840 843..1751 4545 100 Plus
chr3R 27901430 chr3R 21089254..21089633 272..651 1900 100 Plus
chr3R 27901430 chr3R 21088927..21089197 1..271 1355 100 Plus
chr3R 27901430 chr3R 21089685..21089876 651..842 960 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:17:19
Subject Length Description Subject Range Query Range Score Percent Strand
RIOK2-RA 1617 CG11859-PA 1..1617 64..1680 8085 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:12:06 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:17:18
Subject Length Description Subject Range Query Range Score Percent Strand
RIOK2-RA 1751 CG11859-RA 1..1751 1..1751 8755 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:17:21
Subject Length Description Subject Range Query Range Score Percent Strand
RIOK2-PA 538 CG11859-PA 1..538 64..1677 2573 100 Plus
RIOK1-PB 585 CG11660-PB 191..395 310..891 166 24.3 Plus
RIOK1-PA 585 CG11660-PA 191..395 310..891 166 24.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:17:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25266849..25267757 843..1751 4545 100 Plus
3R 32079331 3R 25266171..25266550 272..651 1900 100 Plus
3R 32079331 3R 25265844..25266114 1..271 1355 100 Plus
3R 32079331 3R 25266602..25266793 651..842 960 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25007680..25008588 843..1751 4545 100 Plus
3R 31820162 3R 25007002..25007381 272..651 1900 100 Plus
3R 31820162 3R 25006675..25006945 1..271 1355 100 Plus
3R 31820162 3R 25007433..25007624 651..842 960 100 Plus
Blast to na_te.dros performed 2014-11-27 12:17:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 422..523 1252..1354 125 61.9 Plus
Dvir\Ulysses 10653 Dvir\Ulysses DVULYSS 10653bp AKA(S37633) Derived from X56645 (Rel. 38, Last updated, Version 6). 8939..9040 1252..1354 125 61.9 Plus

MIP10156.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:43:19 Download gff for MIP10156.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21089932..21090840 843..1752 94   Plus
chr3R 21089685..21089876 651..842 100 -> Plus
chr3R 21089254..21089632 272..650 100 -> Plus
chr3R 21088927..21089197 1..271 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:34 Download gff for MIP10156.complete
Subject Subject Range Query Range Percent Splice Strand
CG11859-RA 1..1617 64..1680 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:46:20 Download gff for MIP10156.complete
Subject Subject Range Query Range Percent Splice Strand
CG11859-RA 1..1617 64..1680 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:47 Download gff for MIP10156.complete
Subject Subject Range Query Range Percent Splice Strand
CG11859-RA 1..1617 64..1680 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:43:19 Download gff for MIP10156.complete
Subject Subject Range Query Range Percent Splice Strand
RIOK2-RA 1..1617 64..1680 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-20 10:27:43 Download gff for MIP10156.complete
Subject Subject Range Query Range Percent Splice Strand
CG11859-RA 1..1617 64..1680 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:46:20 Download gff for MIP10156.complete
Subject Subject Range Query Range Percent Splice Strand
CG11859-RA 1..1751 1..1751 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:47 Download gff for MIP10156.complete
Subject Subject Range Query Range Percent Splice Strand
CG11859-RA 1..1751 1..1751 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:43:19 Download gff for MIP10156.complete
Subject Subject Range Query Range Percent Splice Strand
RIOK2-RA 1..1751 1..1751 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:43:19 Download gff for MIP10156.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25266849..25267757 843..1752 99   Plus
3R 25266602..25266793 651..842 100 -> Plus
3R 25266171..25266549 272..650 100 -> Plus
3R 25265844..25266114 1..271 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:47 Download gff for MIP10156.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21092571..21093479 843..1752 99   Plus
arm_3R 21092324..21092515 651..842 100 -> Plus
arm_3R 21091893..21092271 272..650 100 -> Plus
arm_3R 21091566..21091836 1..271 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:21:40 Download gff for MIP10156.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25007680..25008588 843..1752 99   Plus
3R 25007433..25007624 651..842 100 -> Plus
3R 25007002..25007380 272..650 100 -> Plus
3R 25006675..25006945 1..271 100 -> Plus

MIP10156.pep Sequence

Translation from 0 to 1679

> MIP10156.pep
ACTCETKTLLNALLNCQNRTKMGKLNVTVLRYLTKEDFRVLTAIEMGMKN
HELVPGPLAAAIANLKSGGVHKLLKELCKHKLLAYERGKKYDGYRLTNTG
YDYLALKSLTLRGSVSSFGNQIGIGKESNIYVVADEEGTPICLKLHRLGR
TCFRNVKAKRDYHGRRHKASWLYLSRISATREFAYMSALYDRGFPVPKPI
DFNRHCVLMDLVKGWPMTQVHELLDAPQVYDDLMNLIVRLGNSGVIHGDF
NEFNLMVTDAGKPILIDFPQMMSTSHENAEFFFERDVNCVREMFRRKFGY
ESEDYPKFSDLVREDDLDAEVHCTGYGFTKEMEQDLLEEYGMVDQADEED
EGEDLEEEEEPPTLVTAASVEIDECRRQVENEVIYSEAKPTQKSDDAVRR
YIESCTQYLGNLSVGPEVPDQTMPKKLDISLPAETPDVIPFEAETSATNT
VEEDVKSISSNDLDTDEVPELVGLDPNSRMYRLKMVEQMLNDARSQRSYS
TTTSTIAPSVITDRIRRNMDIKEKREQRKKCVAKGEASAVHRHRKENKDV
VKEYAGWDF*

MIP10156.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:55:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17559-PA 524 GF17559-PA 1..524 22..559 2502 88.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:55:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11385-PA 538 GG11385-PA 1..538 22..559 2715 95.4 Plus
Dere\GG13901-PA 580 GG13901-PA 187..391 104..297 176 24.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17367-PA 555 GH17367-PA 1..555 22..559 2473 84.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:55:34
Subject Length Description Subject Range Query Range Score Percent Strand
RIOK2-PA 538 CG11859-PA 1..538 22..559 2813 100 Plus
RIOK1-PB 585 CG11660-PB 191..395 104..297 166 24.3 Plus
RIOK1-PA 585 CG11660-PA 191..395 104..297 166 24.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:55:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23905-PA 544 GI23905-PA 1..544 22..559 2487 83.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:55:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21711-PA 549 GL21711-PA 1..549 22..559 2526 86.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:55:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11242-PA 549 GA11242-PA 1..549 22..559 2529 86.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:55:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17828-PA 538 GM17828-PA 1..538 22..559 2766 97.8 Plus
Dsec\GM24726-PA 586 GM24726-PA 192..396 104..297 177 24.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:55:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21196-PA 538 GD21196-PA 1..538 22..559 2859 98.3 Plus
Dsim\GD12787-PA 585 GD12787-PA 191..395 104..297 176 24.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:55:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24001-PA 550 GJ24001-PA 1..550 22..559 2464 84.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:55:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12926-PA 545 GK12926-PA 1..545 22..559 2391 82.4 Plus
Dwil\GK10469-PA 580 GK10469-PA 190..394 104..297 191 26.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23582-PA 538 GE23582-PA 1..538 22..559 2732 96.5 Plus

MIP10156.hyp Sequence

Translation from 0 to 1679

> MIP10156.hyp
ACTCETKTLLNALLNCQNRTKMGKLNVTVLRYLTKEDFRVLTAIEMGMKN
HELVPGPLAAAIANLKSGGVHKLLKELCKHKLLAYERGKKYDGYRLTNTG
YDYLALKSLTLRGSVSSFGNQIGIGKESNIYVVADEEGTPICLKLHRLGR
TCFRNVKAKRDYHGRRHKASWLYLSRISATREFAYMSALYDRGFPVPKPI
DFNRHCVLMDLVKGWPMTQVHELLDAPQVYDDLMNLIVRLGNSGVIHGDF
NEFNLMVTDAGKPILIDFPQMMSTSHENAEFFFERDVNCVREMFRRKFGY
ESEDYPKFSDLVREDDLDAEVHCTGYGFTKEMEQDLLEEYGMVDQADEED
EGEDLEEEEEPPTLVTAASVEIDECRRQVENEVIYSEAKPTQKSDDAVRR
YIESCTQYLGNLSVGPEVPDQTMPKKLDISLPAETPDVIPFEAETSATNT
VEEDVKSISSNDLDTDEVPELVGLDPNSRMYRLKMVEQMLNDARSQRSYS
TTTSTIAPSVITDRIRRNMDIKEKREQRKKCVAKGEASAVHRHRKENKDV
VKEYAGWDF*

MIP10156.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
RIOK2-PA 538 CG11859-PA 1..538 22..559 2813 100 Plus
RIOK1-PB 585 CG11660-PB 191..395 104..297 166 24.3 Plus
RIOK1-PA 585 CG11660-PA 191..395 104..297 166 24.3 Plus