Clone MIP10221 Report

Search the DGRC for MIP10221

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:102
Well:21
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG13223-RA
Protein status:MIP10221.pep: gold
Sequenced Size:1801

Clone Sequence Records

MIP10221.complete Sequence

1801 bp assembled on 2009-06-09

GenBank Submission: BT088790.1

> MIP10221.complete
ATAAGATGCCTAGGGTTTTTGATCAGCTCACAAGAATAAATAGTCGGGAG
ACTTATGAACCAAGCTAAAAATGCGTTCCGAAATATCTTGCTCCATGGTG
CACGATCTGCTGGAGTCACAAAAATGCAAATTTGTGCAAACGACACCTGA
TTGTCTAATCAATATGAATTTGTTCAACTACCTGGGATGGCATTATTGCA
AGGTGGATGTCCGAAATAGTTTCAATTCCTTCTGGAGTGTGTTGGGCATG
TTTCTGATTACCATTTATGTCTTCTGGATGATGCAAATAACAATAAAAAA
CTACTTCTGTCCAACTTTGATGGTAATCGCAGACTTATTGCGAATGAACG
AGAGCACGGCTGGAGTTACAGTTCTGGCCATTGCAAATGGATCACCGGAT
TTCTTCACGGCGATTGCCTCGAGAGTGCAGACCTCCAAGCACTCATTCCT
CTCGTGCATGTCGCAGGCCATGTTTCTGCACATCTTTGTGGCCGGACTGG
TGATCCTGACCAAGCCCTTCAATATGCGGGCAAACACTTACCTGAGGGAT
TTCGGTTTCCTGTTCCTCAATACGGTCTACATGGATTACATCCACAAGCG
ACCCAAGGGAATCAGCTGGCTAGCTGCGTTGCCCAGTGCCTTCATATTCG
TTGGCTATGTGGTGGTGGCCATCGTTGATCAGCATTTGCTGATTGCCCGC
ATTCAGAAAATGGAGCAAAGACAACTGAATGTGGCTGAGGCGTTGCAGCT
GGAGGAACTGAAGCCGCAGAAGGAGATGCCACTGAAGCGGCAAGAAATCG
ATCGACCCTCCATTGGACACGGAAGTCGAAATAAGCGAATATTCCGGCAA
TTTTGGAATACCGTTGCCGAATTCGACAAGGATCGATTTCATCGGGGAAC
CTTCCTGGTGAAGCTGTATCTGATAGTGAAGCAACCCATCGATATGTTGT
TGAGAATACTCATTCCAAAGGTCGACATGGAGGCACCCCAGTACGGATGG
TCCAAGCTGCTCTTTAACATCCAGGTGGTTCTTGTACCCACCTACATAGC
CTACATAATAGTTCGAGGATATAGCATTGCGGGCTTAGCCGTCTATATGA
TTGCGCTGATCCTAATGATTCCTGTGGCTACATTGATATTTTTTCTCACG
CGCACTGACACCCCGCCCATATTTTTCAGGTTTACATCTGGCGTGGGTTT
CATGGCCGCCGTCTTCCTGATCTTCTGCTTAACCACCGAGGTGAATGCCA
TGTTCTTTACGATGGCGACCATATTGCAAGTAAGCCAGGAATTCTCACTT
GCCACGGCCATTTGCTGGGCACTAAGTAGCAACGATTTGGTGGCCAATCT
GTCACTGGCCCATCAGGGATGGCCTCGCATGGCAATGACGGCCACATTCT
CAGCACCAGTATTTGCATCCTTTGTTTTCTTGGCCCTGCCATTGGTGGTG
AACTCGTTTGTAAACGCGCCCGGTAACATATTCCCAACGGAAGGTGGATT
TGGGGAGACGGTTTGCATCTTCTTGGAGGTTGGAATGGGCTTCTCCATGC
TTTCCGTACTAACCACAAACTTTAAGCTGCGACGAGCTTGTGGCTTTCTA
CTCGTTTCCTACTACATTTTCTTCGTGGGAGTTCTAATTCTGCTGGAGAA
GGGCGTAATCCATGCATACGGCGTGTAAACAGGAAGACAGCCTATACTGG
GAGTCTGAAACCCATAACTTATGCAAATTGCGAGATGATTTATGCCTCAT
TATATAACCAATTCCATTCATAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
A

MIP10221.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG13223-RA 1769 CG13223-RA 1..1769 1..1769 8845 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 12:06:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 7144335..7144738 304..707 1990 99.5 Plus
chr2R 21145070 chr2R 7144789..7145142 708..1061 1770 100 Plus
chr2R 21145070 chr2R 7143971..7144273 1..303 1515 100 Plus
chr2R 21145070 chr2R 7145946..7146231 1484..1769 1430 100 Plus
chr2R 21145070 chr2R 7145526..7145761 1180..1415 1180 100 Plus
chr2R 21145070 chr2R 7145196..7145316 1060..1180 605 100 Plus
chr2R 21145070 chr2R 7145818..7145886 1415..1483 345 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:06:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG13223-RA 1584 CG13223-PA 1..1584 95..1678 7920 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:12:10 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:06:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG13223-RA 1769 CG13223-RA 1..1769 1..1769 8845 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 12:06:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG13223-PA 527 CG13223-PA 1..527 95..1675 2719 100 Plus
CG12376-PA 617 CG12376-PA 23..606 83..1675 525 25.8 Plus
CG14744-PC 620 CG14744-PC 26..611 83..1669 514 25.2 Plus
CG5348-PB 625 CG5348-PB 31..612 83..1669 475 25 Plus
CG14743-PB 611 CG14743-PB 24..601 83..1669 457 22.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 12:06:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 11256871..11257274 304..707 2020 100 Plus
2R 25286936 2R 11257325..11257678 708..1061 1770 100 Plus
2R 25286936 2R 11256507..11256809 1..303 1515 100 Plus
2R 25286936 2R 11258482..11258767 1484..1769 1430 100 Plus
2R 25286936 2R 11258062..11258297 1180..1415 1180 100 Plus
2R 25286936 2R 11257732..11257852 1060..1180 605 100 Plus
2R 25286936 2R 11258354..11258422 1415..1483 345 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:48:04
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 11258070..11258473 304..707 2020 100 Plus
2R 25260384 2R 11258524..11258877 708..1061 1770 100 Plus
2R 25260384 2R 11257706..11258008 1..303 1515 100 Plus
2R 25260384 2R 11259681..11259966 1484..1769 1430 100 Plus
2R 25260384 2R 11259261..11259496 1180..1415 1180 100 Plus
2R 25260384 2R 11258931..11259051 1060..1180 605 100 Plus
2R 25260384 2R 11259553..11259621 1415..1483 345 100 Plus
Blast to na_te.dros performed on 2014-11-27 12:06:01 has no hits.

MIP10221.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 13:02:00 Download gff for MIP10221.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 7145946..7146232 1484..1771 99   Plus
chr2R 7145819..7145886 1416..1483 100 -> Plus
chr2R 7145527..7145761 1181..1415 100 -> Plus
chr2R 7145198..7145316 1062..1180 100 -> Plus
chr2R 7144789..7145142 708..1061 100 -> Plus
chr2R 7144335..7144738 304..707 99 -> Plus
chr2R 7143971..7144273 1..303 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:10 Download gff for MIP10221.complete
Subject Subject Range Query Range Percent Splice Strand
CG13223-RA 1..1584 95..1678 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:47:24 Download gff for MIP10221.complete
Subject Subject Range Query Range Percent Splice Strand
CG13223-RA 1..1584 95..1678 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:35:35 Download gff for MIP10221.complete
Subject Subject Range Query Range Percent Splice Strand
CG13223-RA 1..1584 95..1678 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:02:00 Download gff for MIP10221.complete
Subject Subject Range Query Range Percent Splice Strand
CG13223-RA 1..1584 95..1678 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-09 09:54:24 Download gff for MIP10221.complete
Subject Subject Range Query Range Percent Splice Strand
CG13223-RA 1..1596 83..1678 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:47:24 Download gff for MIP10221.complete
Subject Subject Range Query Range Percent Splice Strand
CG13223-RA 1..1769 1..1769 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:35:35 Download gff for MIP10221.complete
Subject Subject Range Query Range Percent Splice Strand
CG13223-RA 1..1769 1..1769 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:02:00 Download gff for MIP10221.complete
Subject Subject Range Query Range Percent Splice Strand
CG13223-RA 1..1769 1..1769 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 13:02:00 Download gff for MIP10221.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11258482..11258768 1484..1771 99   Plus
2R 11258355..11258422 1416..1483 100 -> Plus
2R 11258063..11258297 1181..1415 100 -> Plus
2R 11257734..11257852 1062..1180 100 -> Plus
2R 11257325..11257678 708..1061 100 -> Plus
2R 11256871..11257274 304..707 100 -> Plus
2R 11256507..11256809 1..303 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:35:35 Download gff for MIP10221.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 7145987..7146273 1484..1771 99   Plus
arm_2R 7145860..7145927 1416..1483 100 -> Plus
arm_2R 7145568..7145802 1181..1415 100 -> Plus
arm_2R 7145239..7145357 1062..1180 100 -> Plus
arm_2R 7144830..7145183 708..1061 100 -> Plus
arm_2R 7144376..7144779 304..707 100 -> Plus
arm_2R 7144012..7144314 1..303 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:22:52 Download gff for MIP10221.complete
Subject Subject Range Query Range Percent Splice Strand
2R 11259681..11259967 1484..1771 99   Plus
2R 11259554..11259621 1416..1483 100 -> Plus
2R 11259262..11259496 1181..1415 100 -> Plus
2R 11258933..11259051 1062..1180 100 -> Plus
2R 11258524..11258877 708..1061 100 -> Plus
2R 11258070..11258473 304..707 100 -> Plus
2R 11257706..11258008 1..303 100 -> Plus

MIP10221.pep Sequence

Translation from 70 to 1677

> MIP10221.pep
MRSEISCSMVHDLLESQKCKFVQTTPDCLINMNLFNYLGWHYCKVDVRNS
FNSFWSVLGMFLITIYVFWMMQITIKNYFCPTLMVIADLLRMNESTAGVT
VLAIANGSPDFFTAIASRVQTSKHSFLSCMSQAMFLHIFVAGLVILTKPF
NMRANTYLRDFGFLFLNTVYMDYIHKRPKGISWLAALPSAFIFVGYVVVA
IVDQHLLIARIQKMEQRQLNVAEALQLEELKPQKEMPLKRQEIDRPSIGH
GSRNKRIFRQFWNTVAEFDKDRFHRGTFLVKLYLIVKQPIDMLLRILIPK
VDMEAPQYGWSKLLFNIQVVLVPTYIAYIIVRGYSIAGLAVYMIALILMI
PVATLIFFLTRTDTPPIFFRFTSGVGFMAAVFLIFCLTTEVNAMFFTMAT
ILQVSQEFSLATAICWALSSNDLVANLSLAHQGWPRMAMTATFSAPVFAS
FVFLALPLVVNSFVNAPGNIFPTEGGFGETVCIFLEVGMGFSMLSVLTTN
FKLRRACGFLLVSYYIFFVGVLILLEKGVIHAYGV*

MIP10221.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:44:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12538-PA 546 GF12538-PA 6..546 6..535 1596 55.6 Plus
Dana\GF12568-PA 617 GF12568-PA 26..609 5..534 451 25.6 Plus
Dana\GF21641-PA 586 GF21641-PA 6..572 16..534 436 25.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:44:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20183-PA 535 GG20183-PA 1..535 1..535 2534 87.1 Plus
Dere\GG23378-PA 617 GG23378-PA 21..606 3..535 483 24.1 Plus
Dere\GG10623-PA 620 GG10623-PA 24..612 3..534 453 25.8 Plus
Dere\GG20625-PA 623 GG20625-PA 27..611 5..534 437 23.8 Plus
Dere\GG10621-PA 572 GG10621-PA 7..562 27..533 399 25 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17532-PA 1146 GH17532-PA 34..520 7..519 568 27 Plus
Dgri\GH10450-PA 1018 GH10450-PA 13..413 67..464 500 27.9 Plus
Dgri\GH20088-PA 609 GH20088-PA 12..600 2..533 430 24.6 Plus
Dgri\GH21357-PA 588 GH21357-PA 1..580 5..534 404 23.6 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:44:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG13223-PA 527 CG13223-PA 1..527 9..535 2719 100 Plus
CG12376-PA 617 CG12376-PA 23..606 5..535 525 25.8 Plus
CG14744-PC 620 CG14744-PC 26..611 5..533 514 25.2 Plus
CG5348-PB 625 CG5348-PB 31..612 5..533 475 25 Plus
CG14743-PB 611 CG14743-PB 24..601 5..533 457 22.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17702-PA 574 GI17702-PA 33..558 6..534 618 28.8 Plus
Dmoj\GI18804-PA 577 GI18804-PA 4..568 3..533 465 24.7 Plus
Dmoj\GI20772-PA 611 GI20772-PA 12..602 16..533 376 22.1 Plus
Dmoj\GI11858-PA 597 GI11858-PA 5..585 15..531 367 22.8 Plus
Dmoj\GI11859-PA 567 GI11859-PA 2..539 42..517 299 22.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:44:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17721-PA 546 GL17721-PA 15..544 6..535 1544 55 Plus
Dper\GL17116-PA 621 GL17116-PA 21..609 3..534 476 24.5 Plus
Dper\GL17364-PA 592 GL17364-PA 2..584 3..534 434 25 Plus
Dper\GL17363-PA 310 GL17363-PA 48..286 250..475 227 27.5 Plus
Dper\GL17118-PA 368 GL17118-PA 6..171 16..182 157 22.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:44:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12135-PA 546 GA12135-PA 10..544 1..535 1543 54.7 Plus
Dpse\GA11592-PA 621 GA11592-PA 21..609 3..534 474 24.5 Plus
Dpse\GA24229-PA 589 GA24229-PA 1..581 5..534 433 25.3 Plus
Dpse\GA24975-PC 601 GA24975-PC 1..593 5..534 398 23.4 Plus
Dpse\GA24975-PB 595 GA24975-PB 6..587 16..534 393 23.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21271-PA 535 GM21271-PA 1..535 1..535 2758 96.1 Plus
Dsec\GM21058-PA 596 GM21058-PA 23..584 5..534 497 25.5 Plus
Dsec\GM21719-PA 605 GM21719-PA 12..593 5..534 441 25.7 Plus
Dsec\GM20668-PA 560 GM20668-PA 3..552 42..534 405 25.5 Plus
Dsec\GM20667-PA 572 GM20667-PA 7..562 27..533 398 22.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10783-PA 535 GD10783-PA 1..535 1..535 2757 96.3 Plus
Dsim\GD10146-PA 620 GD10146-PA 24..612 3..534 462 25.7 Plus
Dsim\GD11214-PA 624 GD11214-PA 31..612 5..534 432 25.5 Plus
Dsim\GD10141-PA 763 GD10141-PA 172..753 1..533 417 22.6 Plus
Dsim\GD10142-PA 623 GD10142-PA 3..333 42..323 210 25.5 Plus
Dsim\GD10141-PA 763 GD10141-PA 7..139 27..160 161 29.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:44:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11398-PA 580 GJ11398-PA 34..563 7..534 643 29.8 Plus
Dvir\GJ21831-PA 601 GJ21831-PA 13..592 3..533 419 24.6 Plus
Dvir\GJ24540-PA 560 GJ24540-PA 19..517 3..449 406 25.2 Plus
Dvir\GJ20506-PA 748 GJ20506-PA 2..476 42..444 249 23.1 Plus
Dvir\GJ22726-PA 2682 GJ22726-PA 19..170 3..156 186 27.9 Plus
Dvir\GJ20506-PA 748 GJ20506-PA 552..740 345..534 170 24.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:44:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18715-PA 563 GK18715-PA 8..547 17..534 545 26.1 Plus
Dwil\GK21735-PA 626 GK21735-PA 20..614 3..534 484 24.6 Plus
Dwil\GK21736-PA 591 GK21736-PA 6..583 16..534 405 23.6 Plus
Dwil\GK21568-PA 389 GK21568-PA 92..380 253..533 247 24.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:44:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12870-PA 535 GE12870-PA 1..535 1..535 2562 87.7 Plus
Dyak\GE19220-PA 617 GE19220-PA 21..606 3..535 492 24.1 Plus
Dyak\GE11815-PA 621 GE11815-PA 31..608 5..533 442 24.6 Plus
Dyak\GE22811-PA 560 GE22811-PA 3..552 42..534 411 25.6 Plus
Dyak\GE22802-PA 572 GE22802-PA 7..562 27..533 343 23.3 Plus

MIP10221.hyp Sequence

Translation from 70 to 1677

> MIP10221.hyp
MRSEISCSMVHDLLESQKCKFVQTTPDCLINMNLFNYLGWHYCKVDVRNS
FNSFWSVLGMFLITIYVFWMMQITIKNYFCPTLMVIADLLRMNESTAGVT
VLAIANGSPDFFTAIASRVQTSKHSFLSCMSQAMFLHIFVAGLVILTKPF
NMRANTYLRDFGFLFLNTVYMDYIHKRPKGISWLAALPSAFIFVGYVVVA
IVDQHLLIARIQKMEQRQLNVAEALQLEELKPQKEMPLKRQEIDRPSIGH
GSRNKRIFRQFWNTVAEFDKDRFHRGTFLVKLYLIVKQPIDMLLRILIPK
VDMEAPQYGWSKLLFNIQVVLVPTYIAYIIVRGYSIAGLAVYMIALILMI
PVATLIFFLTRTDTPPIFFRFTSGVGFMAAVFLIFCLTTEVNAMFFTMAT
ILQVSQEFSLATAICWALSSNDLVANLSLAHQGWPRMAMTATFSAPVFAS
FVFLALPLVVNSFVNAPGNIFPTEGGFGETVCIFLEVGMGFSMLSVLTTN
FKLRRACGFLLVSYYIFFVGVLILLEKGVIHAYGV*

MIP10221.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:13:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG13223-PA 527 CG13223-PA 1..527 9..535 2719 100 Plus
CG12376-PA 617 CG12376-PA 23..606 5..535 525 25.8 Plus
CG14744-PC 620 CG14744-PC 26..611 5..533 514 25.2 Plus
CG5348-PB 625 CG5348-PB 31..612 5..533 475 25 Plus
CG14743-PB 611 CG14743-PB 24..601 5..533 457 22.6 Plus