Clone MIP10548 Report

Search the DGRC for MIP10548

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:104
Well:48
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG15597-RB
Protein status:MIP10548.pep: gold
Sequenced Size:712

Clone Sequence Records

MIP10548.complete Sequence

712 bp assembled on 2009-05-21

GenBank Submission: BT083467.1

> MIP10548.complete
ATTAGTTCTACTTGTGCCTCTCGAGCGTTCGCAGTCCGCAATGAAAGTAT
TCGTATGTCTTCTGGCTCTGACAGCCATCCTGGCAACCGCCAACGCCGGT
CTCCTCAGTCTGCTCAAGGGAGGCGGTGGTGGTGGTGGCGGTGGCTATGG
CGGCGGATACGGTGGTGGCTACGGCGGCGGCTACGGAGGTGGTGGGTATG
GAGGCGAGAGCACCGTGAAGGTCATTAAAGTGATAACCGATTCCGGAGCT
GGCGGTGGCTACCGCGGAGGATACGCAGGTGGCTATGGAGGTGGCTACGG
AGGTGGCTACGGAGGTGCCTACGGTGGTGGCTACGGAGGTGGCAGCACTG
TTAAAATTATTAAAGTGATCACCGATTCCGGATCCGGCTACGGAGGTGGA
TACGGTGGAGGTGGCTGGACCTCGGGCAGCTACGGGGGCAGTTACGCTGG
TGGCTACGGTGGTCAGTCCGGATGGTGGAAGACGAAGTGAGCAGATGAAC
CACTCTCCTTTTAGATGTAGTCCGGATATAAACTCGTTTATGTACCTGAA
AAAAAAACATTCCATAGCCAAGTAACCCGAATCTCTTTAATGCCAGTTAT
TTCCAAGTTAGCGAAACTAGTTTGAGATGATCCGCAGACTGCTTGGCGAA
CTCAAAAAAAAATAAATCTTAATTTAAATAAAAAAAAGAAAAAAAAAAAA
AAAAAAAAAAAA

MIP10548.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:30:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG15597.a 1186 CG15597.a 345..1030 1..686 3415 99.8 Plus
CG15597-RB 1001 CG15597-RB 160..845 1..686 3415 99.8 Plus
CG14191-RA 974 CG14191-RA 391..552 160..315 310 81.4 Plus
CG14191-RA 974 CG14191-RA 491..556 278..343 210 87.8 Plus
CG14191-RA 974 CG14191-RA 487..544 286..343 185 87.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:58:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2110125..2110764 686..47 3185 99.8 Minus
chrX 22417052 chrX 18970927..18971105 160..332 270 79.3 Plus
chr3R 27901430 chr3R 2110822..2110870 49..1 245 100 Minus
chr3R 27901430 chr3R 2110429..2110533 247..140 190 80.6 Minus
chr3R 27901430 chr3R 2110564..2110671 382..278 190 80.6 Minus
chr3R 27901430 chr3R 2110470..2110533 317..254 185 85.9 Minus
chr3R 27901430 chr3R 2110494..2110557 341..278 185 85.9 Minus
chrX 22417052 chrX 18971027..18971092 278..343 180 84.8 Plus
chrX 22417052 chrX 18971047..18971136 250..339 180 80 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG15597-RB 450 CG15597-PB 1..450 41..490 2250 100 Plus
CG14191-RA 582 CG14191-PA 171..332 160..315 290 81.5 Plus
CG14191-RA 582 CG14191-PA 271..336 278..343 210 87.9 Plus
CG15597-RB 450 CG15597-PB 100..207 278..382 190 80.6 Plus
CG15597-RB 450 CG15597-PB 238..342 140..247 190 80.6 Plus
CG15597-RB 450 CG15597-PB 214..277 278..341 185 85.9 Plus
CG15597-RB 450 CG15597-PB 238..301 254..317 185 85.9 Plus
CG14191-RA 582 CG14191-PA 267..324 286..343 185 87.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:12:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG15597-RB 679 CG15597-RB 1..679 1..679 3395 100 Plus
CG14191-RA 787 CG14191-RA 250..411 160..315 290 81.5 Plus
CG14191-RA 787 CG14191-RA 350..415 278..343 210 87.9 Plus
CG15597-RB 679 CG15597-RB 140..247 278..382 190 80.6 Plus
CG15597-RB 679 CG15597-RB 278..382 140..247 190 80.6 Plus
CG15597-RB 679 CG15597-RB 254..317 278..341 185 85.9 Plus
CG15597-RB 679 CG15597-RB 278..341 254..317 185 85.9 Plus
CG14191-RA 787 CG14191-RA 346..403 286..343 185 87.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed on 2014-11-27 03:58:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:57:56
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 6284455..6285094 686..47 3185 99.8 Minus
X 23542271 X 19082029..19082190 160..315 290 81.5 Plus
3R 32079331 3R 6285152..6285200 49..1 245 100 Minus
X 23542271 X 19082129..19082194 278..343 210 87.9 Plus
3R 32079331 3R 6284759..6284863 247..140 190 80.6 Minus
3R 32079331 3R 6284894..6285001 382..278 190 80.6 Minus
3R 32079331 3R 6284800..6284863 317..254 185 85.9 Minus
3R 32079331 3R 6284824..6284887 341..278 185 85.9 Minus
X 23542271 X 19082125..19082182 286..343 185 87.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:28
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6025286..6025925 686..47 3185 99.8 Minus
X 23527363 X 19090127..19090288 160..315 310 81.4 Plus
3R 31820162 3R 6025983..6026031 49..1 245 100 Minus
X 23527363 X 19090227..19090292 278..343 210 87.8 Plus
X 23527363 X 19090223..19090280 286..343 185 87.9 Plus
Blast to na_te.dros performed on 2014-11-27 03:57:58 has no hits.

MIP10548.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:34:06 Download gff for MIP10548.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2110825..2110870 1..46 100   Minus
chr3R 2110693..2110764 47..118 100 <- Minus
chr3R 2110561..2110615 196..250 100 == Minus
chr3R 2110161..2110464 347..650 100 == Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:09:35 Download gff for MIP10548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15597-RA 55..91 1..37 100 == Plus
CG15597-RA 92..516 65..490 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:46:23 Download gff for MIP10548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15597-RB 1..450 41..490 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:24:18 Download gff for MIP10548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15597-RB 1..450 41..490 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:34:06 Download gff for MIP10548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15597-RB 1..450 41..490 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-21 09:50:21 Download gff for MIP10548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15597-RA 55..91 1..37 100 == Plus
CG15597-RA 92..516 65..490 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:46:23 Download gff for MIP10548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15597-RB 1..682 1..682 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:24:18 Download gff for MIP10548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15597-RB 1..682 1..682 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:34:06 Download gff for MIP10548.complete
Subject Subject Range Query Range Percent Splice Strand
CG15597-RB 1..679 1..679 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:34:06 Download gff for MIP10548.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6285155..6285200 1..46 100   Minus
3R 6284452..6285094 47..688 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:24:18 Download gff for MIP10548.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2110877..2110922 1..46 100   Minus
arm_3R 2110174..2110816 47..688 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:21:43 Download gff for MIP10548.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6025986..6026031 1..46 100   Minus
3R 6025283..6025925 47..688 99 <- Minus

MIP10548.hyp Sequence

Translation from 0 to 489

> MIP10548.hyp
LVLLVPLERSQSAMKVFVCLLALTAILATANAGLLSLLKGGGGGGGGGYG
GGYGGGYGGGYGGGGYGGESTVKVIKVITDSGAGGGYRGGYAGGYGGGYG
GGYGGAYGGGYGGGSTVKIIKVITDSGSGYGGGYGGGGWTSGSYGGSYAG
GYGGQSGWWKTK*

MIP10548.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG15597-PB 149 CG15597-PB 1..149 14..162 829 100 Plus
CG14191-PA 193 CG14191-PA 1..188 14..158 449 53.4 Plus
CG12523-PB 250 CG12523-PB 1..158 14..161 339 50.6 Plus
CG12523-PA 250 CG12523-PA 1..158 14..161 339 50.6 Plus
CG15731-PA 319 CG15731-PA 1..199 14..157 317 41.8 Plus

MIP10548.pep Sequence

Translation from 1 to 489

> MIP10548.pep
LVLLVPLERSQSAMKVFVCLLALTAILATANAGLLSLLKGGGGGGGGGYG
GGYGGGYGGGYGGGGYGGESTVKVIKVITDSGAGGGYRGGYAGGYGGGYG
GGYGGAYGGGYGGGSTVKIIKVITDSGSGYGGGYGGGGWTSGSYGGSYAG
GYGGQSGWWKTK*

MIP10548.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG15597-PB 149 CG15597-PB 1..149 14..162 829 100 Plus
CG14191-PA 193 CG14191-PA 1..188 14..158 449 53.4 Plus
CG12523-PB 250 CG12523-PB 1..158 14..161 339 50.6 Plus
CG12523-PA 250 CG12523-PA 1..158 14..161 339 50.6 Plus
CG15731-PA 319 CG15731-PA 1..199 14..157 317 41.8 Plus