Clone MIP10555 Report

Search the DGRC for MIP10555

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:104
Well:55
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG10029-RA
Protein status:MIP10555.pep: gold
Sequenced Size:1408

Clone Sequence Records

MIP10555.complete Sequence

1408 bp assembled on 2009-06-11

GenBank Submission: BT088809.1

> MIP10555.complete
GATTCAAAAAAAAGTTCACCAAAAGTAAGTAGTTGAAGATGAAAGTGGTC
GGCAGTTTGCATATCCTCTATTCGCTGGCGATCTTAGTATCCCTACATTC
TCTCGTCGCGGGAAACTCTTCGGTGGTGGCGGTGACCCACGAAAACTTGC
AAGGAATAATCGATTCTAATGAGTTGGTTCTGCTTAGTTTTTACACGGAT
TGGTGCCGTTTTAGCCAGATTTTGCAGCCCATTTTTGAGGAGGCGGCGGC
GAAGGTTATACAGAAATTCCCTGAAAACGGCCGTGTGATCCTGGGAAAAG
TAAACTGCGACACTGAAGATATATTGGCCGATCAGTTTGACATACTTAAG
TACCCAACGATAAAGATCGTCAGGAATGGATTGATTGGCAATCAGGAATA
CCGTGGCCAGAGATCGGTGGAGGCCCTTTTCCAGTTCGTGGAAAAGGAGC
TATCAGATCCAATCAAAGAGTTCCATAACATTGATGACCTTAAAAACGTG
GATGTTGGGTATGGAATAGTCATTGGTTATTTCATTTCCAAGGATCATGC
TGAGTATGATAACTATCGCAGGGTAGCGAGCCTTTTGCGCAACGATTGTA
GGTTCCTTGTGGGCTTTGGTGACTTGACTAAGGACCTCCGACCGCCAGGA
AAGAACGCGTTGATCTTCCGAGGCGATCCATCGATTCCGAATCACAAAAA
CCAGTACAGTGAGTACTTGGGCAACATGACCAGCTTTAAAGAACTAACCT
TTTGGATCGATAAGACGTGTGTGCCCCTGGTGCGAGAGGTCACCTTCGAT
AATGCAGAGGAACTATCGGAGGAAGGATTACCATTTGTATTGCTATTTTA
CAACAAGGACGATCTAAGTCCCATCCAGGAGTTCAAGAACGCAATTCAAA
GCCAGATGGAAAATGAGACGAGGGTTATTTTCCTGACTGCCGAAGGAGAA
GTCTTTAAGCACCCACTTTTCCATTTGGGAAAGTCCCCGAGTGATTTGCC
AGTGATCGCAATCGATTCCTTCATGCACATGTACCTATTTCCACGCTTCC
AGGACATTTACGATCCAGGTGCCCTCAAAAAGTTCATTGATGACCTGTTC
AGCGGTGCACTGCATTATAATTACCATGTGGCCCAGCAGGCTAAGGAAGA
TTTGGAGTCCATTATCGATCCAACTGAAGACCTGCCAGTCGTTCACGAGT
CCAAGTTTAAGGACCTCAAGCCATCCAAGCACCGTTACACGTTGGTCAAC
CGCACAAGGGACGAGCTATAATATTATCCTACTCTACCATAATCTTTGCT
CATGCTTAGGTGTAATCATTTAATATCGGTTTAAGTCAGATTCTTAAACG
TAAGAATATTAATTTATTTAACTTGACGCTAAAAAAAAAAAAAAAAAAAA
AAAAAAAA

MIP10555.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG10029.a 1673 CG10029.a 1..1381 9..1389 6860 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3141819..3142599 1380..600 3905 100 Minus
chr3R 27901430 chr3R 3142700..3143302 603..1 3000 99.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG10029-RB 1233 CG10029-PB 1..1233 39..1271 6150 99.9 Plus
CG10029-RA 1233 CG10029-PA 1..1233 39..1271 6150 99.9 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:12:24 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG10029-RB 1665 CG10029-RB 1..1380 1..1380 6885 99.9 Plus
CG10029-RA 1380 CG10029-RA 1..1380 1..1380 6885 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG10029-PB 410 CG10029-PB 3..409 45..1265 2123 100 Plus
CG10029-PA 410 CG10029-PA 3..409 45..1265 2123 100 Plus
CG9911-PA 412 CG9911-PA 8..409 48..1253 1038 49.8 Plus
CG9911-PB 412 CG9911-PB 8..409 48..1253 1038 49.8 Plus
CG9911-PD 412 CG9911-PD 8..409 48..1253 1038 49.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7315715..7316504 1389..600 3920 99.7 Minus
3R 32079331 3R 7316605..7317207 603..1 3000 99.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7056546..7057335 1389..600 3920 99.7 Minus
3R 31820162 3R 7057436..7058038 603..1 3000 99.8 Minus
Blast to na_te.dros performed on 2014-11-27 15:45:46 has no hits.

MIP10555.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:36:31 Download gff for MIP10555.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3142702..3143302 1..601 99   Minus
chr3R 3141819..3142597 602..1380 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:26 Download gff for MIP10555.complete
Subject Subject Range Query Range Percent Splice Strand
CG10029-RA 1..1233 39..1271 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:47:44 Download gff for MIP10555.complete
Subject Subject Range Query Range Percent Splice Strand
CG10029-RA 1..1233 39..1271 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:05:58 Download gff for MIP10555.complete
Subject Subject Range Query Range Percent Splice Strand
CG10029-RA 1..1233 39..1271 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:36:31 Download gff for MIP10555.complete
Subject Subject Range Query Range Percent Splice Strand
CG10029-RA 1..1233 39..1271 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-11 13:28:36 Download gff for MIP10555.complete
Subject Subject Range Query Range Percent Splice Strand
CG10029-RA 1..1233 39..1271 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:47:44 Download gff for MIP10555.complete
Subject Subject Range Query Range Percent Splice Strand
CG10029-RA 1..1380 1..1380 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:05:58 Download gff for MIP10555.complete
Subject Subject Range Query Range Percent Splice Strand
CG10029-RA 1..1380 1..1380 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:36:31 Download gff for MIP10555.complete
Subject Subject Range Query Range Percent Splice Strand
CG10029-RA 1..1380 1..1380 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:36:31 Download gff for MIP10555.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7316607..7317207 1..601 99   Minus
3R 7315724..7316502 602..1380 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:05:58 Download gff for MIP10555.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3142329..3142929 1..601 99   Minus
arm_3R 3141446..3142224 602..1380 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:23:13 Download gff for MIP10555.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7057438..7058038 1..601 99   Minus
3R 7056555..7057333 602..1380 100 <- Minus

MIP10555.pep Sequence

Translation from 38 to 1270

> MIP10555.pep
MKVVGSLHILYSLAILVSLHSLVAGNSSVVAVTHENLQGIIDSNELVLLS
FYTDWCRFSQILQPIFEEAAAKVIQKFPENGRVILGKVNCDTEDILADQF
DILKYPTIKIVRNGLIGNQEYRGQRSVEALFQFVEKELSDPIKEFHNIDD
LKNVDVGYGIVIGYFISKDHAEYDNYRRVASLLRNDCRFLVGFGDLTKDL
RPPGKNALIFRGDPSIPNHKNQYSEYLGNMTSFKELTFWIDKTCVPLVRE
VTFDNAEELSEEGLPFVLLFYNKDDLSPIQEFKNAIQSQMENETRVIFLT
AEGEVFKHPLFHLGKSPSDLPVIAIDSFMHMYLFPRFQDIYDPGALKKFI
DDLFSGALHYNYHVAQQAKEDLESIIDPTEDLPVVHESKFKDLKPSKHRY
TLVNRTRDEL*

MIP10555.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17308-PA 408 GF17308-PA 9..408 15..410 1347 62.5 Plus
Dana\GF19631-PA 409 GF19631-PA 16..409 13..410 1061 50.7 Plus
Dana\GF14074-PA 397 GF14074-PA 6..397 3..410 665 39.4 Plus
Dana\GF10739-PA 496 GF10739-PA 21..179 21..183 193 29.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25226-PA 410 GG25226-PA 1..410 1..410 1911 87.1 Plus
Dere\GG19336-PA 412 GG19336-PA 8..412 4..410 1043 49.4 Plus
Dere\GG13681-PA 496 GG13681-PA 1..179 1..183 193 27.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:05:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12152-PA 415 GH12152-PA 13..415 1..410 1062 49.9 Plus
Dgri\GH19278-PA 391 GH19278-PA 22..391 23..410 755 41.9 Plus
Dgri\GH11313-PA 386 GH11313-PA 15..386 27..410 657 38.6 Plus
Dgri\GH23529-PA 305 GH23529-PA 3..305 96..410 503 38.2 Plus
Dgri\GH16892-PA 493 GH16892-PA 25..175 29..183 178 28.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:05:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG10029-PB 410 CG10029-PB 1..410 1..410 2137 100 Plus
CG10029-PA 410 CG10029-PA 1..410 1..410 2137 100 Plus
CG9911-PA 412 CG9911-PA 8..412 4..410 1040 49.9 Plus
CG9911-PB 412 CG9911-PB 8..412 4..410 1040 49.9 Plus
CG9911-PD 412 CG9911-PD 8..412 4..410 1040 49.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10898-PA 408 GI10898-PA 9..408 9..410 1063 51.1 Plus
Dmoj\GI17822-PA 401 GI17822-PA 25..401 26..410 627 37.6 Plus
Dmoj\GI12238-PA 493 GI12238-PA 25..343 29..333 186 23.9 Plus
Dmoj\GI19593-PA 488 GI19593-PA 5..181 13..189 154 26 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12183-PA 411 GL12183-PA 10..411 11..410 1187 52.7 Plus
Dper\GL21325-PA 411 GL21325-PA 31..411 27..410 1032 51.7 Plus
Dper\GL26391-PA 357 GL26391-PA 5..329 4..328 554 40.1 Plus
Dper\GL13169-PA 181 GL13169-PA 6..181 226..410 329 43 Plus
Dper\GL25779-PA 493 GL25779-PA 26..176 29..183 194 29.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:05:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10017-PA 411 GA10017-PA 24..411 23..410 1180 54.6 Plus
Dpse\GA22116-PA 411 GA22116-PA 31..411 27..410 1032 51.7 Plus
Dpse\GA28841-PA 401 GA28841-PA 5..401 4..410 712 40.8 Plus
Dpse\GA20009-PA 493 GA20009-PA 26..176 29..183 194 29.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10486-PA 367 GM10486-PA 1..367 1..410 1801 84.6 Plus
Dsec\GM13413-PA 412 GM13413-PA 8..412 4..410 1058 50.1 Plus
Dsec\GM24501-PA 496 GM24501-PA 1..179 1..183 195 28.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:05:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19485-PA 410 GD19485-PA 1..410 1..410 2063 94.1 Plus
Dsim\GD15757-PA 407 GD15757-PA 8..407 4..410 1038 49.6 Plus
Dsim\GD12572-PA 496 GD12572-PA 1..179 1..183 196 28.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18544-PA 410 GJ18544-PA 13..410 13..410 1058 52 Plus
Dvir\GJ10239-PA 397 GJ10239-PA 19..397 22..410 839 45.3 Plus
Dvir\GJ17318-PA 421 GJ17318-PA 49..421 28..410 643 37.7 Plus
Dvir\GJ11469-PA 493 GJ11469-PA 25..175 29..183 183 28.9 Plus
Dvir\GJ18390-PA 489 GJ18390-PA 2..262 7..274 161 23.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:05:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25202-PA 409 GK25202-PA 17..409 13..410 1033 50.1 Plus
Dwil\GK23703-PA 365 GK23703-PA 3..365 43..410 966 50.9 Plus
Dwil\GK19176-PA 395 GK19176-PA 9..391 13..403 732 39.8 Plus
Dwil\GK15508-PA 390 GK15508-PA 4..390 20..410 650 39.4 Plus
Dwil\GK20490-PA 497 GK20490-PA 12..177 14..183 198 29.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:05:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25795-PA 410 GE25795-PA 1..410 1..410 1966 89.3 Plus
Dyak\GE11116-PA 410 GE11116-PA 1..410 1..410 1957 89.3 Plus
Dyak\GE11008-PA 412 GE11008-PA 8..412 4..410 1051 49.6 Plus
Dyak\GE19977-PA 496 GE19977-PA 1..315 1..323 196 21.5 Plus

MIP10555.hyp Sequence

Translation from 38 to 1270

> MIP10555.hyp
MKVVGSLHILYSLAILVSLHSLVAGNSSVVAVTHENLQGIIDSNELVLLS
FYTDWCRFSQILQPIFEEAAAKVIQKFPENGRVILGKVNCDTEDILADQF
DILKYPTIKIVRNGLIGNQEYRGQRSVEALFQFVEKELSDPIKEFHNIDD
LKNVDVGYGIVIGYFISKDHAEYDNYRRVASLLRNDCRFLVGFGDLTKDL
RPPGKNALIFRGDPSIPNHKNQYSEYLGNMTSFKELTFWIDKTCVPLVRE
VTFDNAEELSEEGLPFVLLFYNKDDLSPIQEFKNAIQSQMENETRVIFLT
AEGEVFKHPLFHLGKSPSDLPVIAIDSFMHMYLFPRFQDIYDPGALKKFI
DDLFSGALHYNYHVAQQAKEDLESIIDPTEDLPVVHESKFKDLKPSKHRY
TLVNRTRDEL*

MIP10555.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG10029-PB 410 CG10029-PB 1..410 1..410 2137 100 Plus
CG10029-PA 410 CG10029-PA 1..410 1..410 2137 100 Plus
CG9911-PA 412 CG9911-PA 8..412 4..410 1040 49.9 Plus
CG9911-PB 412 CG9911-PB 8..412 4..410 1040 49.9 Plus
CG9911-PD 412 CG9911-PD 8..412 4..410 1040 49.9 Plus