Clone MIP11264 Report

Search the DGRC for MIP11264

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:112
Well:64
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG6688-RA
Protein status:MIP11264.pep: gold
Sequenced Size:1805

Clone Sequence Records

MIP11264.complete Sequence

1805 bp assembled on 2009-06-26

GenBank Submission: BT088883.1

> MIP11264.complete
AGTTTGCCAACTGAGAGCGCACGTTGAACACGTCTCTCGCTAGCCGCTTT
TTATTTTGGCCCACAACGCCGAGCACCTGTGCGAGTTTTCTAGCCCGAAA
ATGAGGAAATCAGCGGGAGGATTTCATTCCACATCCAATGAAGATGGGCA
GCATGGCGATGGCTCCTCCGTGCGACTACTGAGAATTCCCAGAGCCGCAC
CTGCGATGGAGAACTACGGATTTCAGCTGACCCGCAGCAAATGGGATCCC
TATCCCTGGGTTTGCGAAGTGGCAGCCGGCACACCTGCCGCTCTCTGCGG
CCTGAAACCCGGCGATTGCGTTCTGGAGGTAAATGGCAACGATGTTTTAG
GCTTGAGAGTGTCTGAAATCGCCAAAATGGTGAAGAGTCAAAAGGACTGC
GTCACAATTCTCTGTTGGAACAGTGAATGTGATAAGGACTGTGATACTAA
TAGCATCTGCTGCGCCCCCATGCCCACCAGTTTGCGCCGCCTGTCCCTCG
TCCTGGAGAGCATCCTGCGCCTCGTCGAGTGTCCTGTCTGCGGGGTGACC
ATCTCACCGCCGGCGATGCAGTGCCAAAACGGACACCTGCTCTGCGTGGA
CTGTCGCATCCGCTCGGAGCGATGTCCTGTCTGCCGGGACTTCTACACTC
CCCGCCGAGCGCTGTTGGCGGAGCAAATTTTCCTGACCATTGCCAACGCC
TTCGAGATGTGCCGCTCGGAGAACAAGCTGCGGCAGAAGCTCTTTGCCGG
GATAACACGGCCAGTCGTGGGCCGACAGGACAGGATAACCGGACAGGACA
CCTGGCGAAAGCGCAGGCCAGTGCTGCCAACGAACAAGTTCCTAACCAAG
TTGCTTGAGGGCTGCGCCTACTCGACGGATAACCTCAGTCCCTCGAATGC
CGCTACTCTGCTGCGGACTAATACCACGGACGTCGCTGGCGACTCCAGTG
AAATCCCGGCCAGAACATCGCCAGTGACAGCCACGCCCCCCGAAAGGACA
ACAATGCATGCCACGCTTGACGCGAATGCGGCGCATCCTTCACTCTCGAC
GAATGATTTACAGCAGGAAGGAGTTAAGCCGAATGCCGAGGGCGTTGACG
AGGAATCCGGAACGAACAGCAGCCACATCTCTGCCACATCCTTGCATGGC
CCTCCGCTACCAGCCTCCGTTAGCCCGGGCATCAATGAATCTTCCGGATT
GCAACCCGTTCGCATACCTCCTGTCACTCCAAGCCAAGATTTGCCCCAGC
AGGTTGTCCAAACTAAGCCGGCCTCGCTGTTGTACCGCTGTCCCTGCAAG
CTGCAGGATCCACAGGATCCTGCAAAGGACCTCCACCAGAACTGCTGCTA
CAAATCCGCTTTCCGTCTGCTTTGAGCTCGGGCATCTCAATCAACAGCAT
CCTCTTATCAGGCGCGTCCCCAATTCGCCCCCCGCCCCTCTTGCTGTTTT
CCTTTCTAATTAAATTAAATGCCAGTTGCTTGGCCAAAGTTGCTTATCGC
GCAAAGAAACGAACCCGGCCAAAGGAATTGTATGGGTGTCAGGCCGGGAC
AAAGGCCCACGCTGGAGATGCAAAGAAGTTGGTCCAGCTAACTGCAGCGA
AGAGTTCAACTTGGCCAAGTTGAGTTCTAATTGAATCACTCCTGAACGCT
CCAATGACTTTGTGTCATTTGGCGTCCGAGTTGGTCAGCTCGATAATGAA
GTCCGGATGGACTGCATTCAGGGAGCGTCGCAAGAGGAATAAAAATATTT
TAAGTCAATTGGACTTTGTGCAAATGAACAAAAAAAAAAAAAAAAAAAAA
AAAAA

MIP11264.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:32:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG6688-RA 1878 CG6688-RA 67..1849 1..1781 8845 99.8 Plus
CG6688.a 2310 CG6688.a 499..2281 1..1781 8845 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 18837533..18838848 452..1767 6505 99.6 Plus
chr3R 27901430 chr3R 18835794..18836056 1..261 1250 99.2 Plus
chr3R 27901430 chr3R 18837296..18837420 327..451 625 100 Plus
chr3R 27901430 chr3R 18836123..18836194 259..330 360 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:53:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG6688-RA 1275 CG6688-PA 1..1275 101..1375 6375 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:12:53 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:53:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG6688-RA 1778 CG6688-RA 1..1778 1..1776 8825 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:53:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG6688-PA 424 CG6688-PA 1..424 101..1372 2262 100 Plus
CG34375-PA 567 CG34375-PA 16..187 218..703 334 40.7 Plus
CG34375-PC 568 CG34375-PC 16..188 218..703 334 40.5 Plus
CG34375-PB 568 CG34375-PB 16..188 218..703 334 40.5 Plus
sinah-PC 351 CG13030-PC 100..155 512..679 155 50 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:53:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 23014151..23015480 452..1781 6635 99.9 Plus
3R 32079331 3R 23012412..23012674 1..261 1250 99.2 Plus
3R 32079331 3R 23013914..23014038 327..451 625 100 Plus
3R 32079331 3R 23012741..23012812 259..330 360 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:49:11
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 22754982..22756311 452..1781 6635 99.9 Plus
3R 31820162 3R 22753243..22753505 1..261 1260 99.2 Plus
3R 31820162 3R 22754745..22754869 327..451 625 100 Plus
3R 31820162 3R 22753572..22753643 259..330 360 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:53:50 has no hits.

MIP11264.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:46:20 Download gff for MIP11264.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 18837533..18838863 452..1779 99   Plus
chr3R 18837298..18837420 329..451 100 -> Plus
chr3R 18836124..18836192 260..328 100 -> Plus
chr3R 18835794..18836054 1..259 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:14 Download gff for MIP11264.complete
Subject Subject Range Query Range Percent Splice Strand
CG6688-RA 1..1275 101..1375 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:49:17 Download gff for MIP11264.complete
Subject Subject Range Query Range Percent Splice Strand
CG6688-RA 1..1275 101..1375 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:40:31 Download gff for MIP11264.complete
Subject Subject Range Query Range Percent Splice Strand
CG6688-RA 1..1275 101..1375 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:46:20 Download gff for MIP11264.complete
Subject Subject Range Query Range Percent Splice Strand
CG6688-RA 1..1275 101..1375 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-30 13:55:04 Download gff for MIP11264.complete
Subject Subject Range Query Range Percent Splice Strand
CG6688-RA 1..1275 101..1375 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:49:17 Download gff for MIP11264.complete
Subject Subject Range Query Range Percent Splice Strand
CG6688-RA 1..1778 1..1776 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:40:31 Download gff for MIP11264.complete
Subject Subject Range Query Range Percent Splice Strand
CG6688-RA 1..1778 1..1776 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:46:20 Download gff for MIP11264.complete
Subject Subject Range Query Range Percent Splice Strand
CG6688-RA 1..1778 1..1776 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:46:20 Download gff for MIP11264.complete
Subject Subject Range Query Range Percent Splice Strand
3R 23014151..23015478 452..1779 99   Plus
3R 23013916..23014038 329..451 100 -> Plus
3R 23012742..23012810 260..328 100 -> Plus
3R 23012412..23012672 1..259 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:40:31 Download gff for MIP11264.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 18839873..18841200 452..1779 99   Plus
arm_3R 18839638..18839760 329..451 100 -> Plus
arm_3R 18838464..18838532 260..328 100 -> Plus
arm_3R 18838134..18838394 1..259 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:25:00 Download gff for MIP11264.complete
Subject Subject Range Query Range Percent Splice Strand
3R 22754982..22756309 452..1779 99   Plus
3R 22754747..22754869 329..451 100 -> Plus
3R 22753573..22753641 260..328 100 -> Plus
3R 22753243..22753503 1..259 99 -> Plus

MIP11264.pep Sequence

Translation from 100 to 1374

> MIP11264.pep
MRKSAGGFHSTSNEDGQHGDGSSVRLLRIPRAAPAMENYGFQLTRSKWDP
YPWVCEVAAGTPAALCGLKPGDCVLEVNGNDVLGLRVSEIAKMVKSQKDC
VTILCWNSECDKDCDTNSICCAPMPTSLRRLSLVLESILRLVECPVCGVT
ISPPAMQCQNGHLLCVDCRIRSERCPVCRDFYTPRRALLAEQIFLTIANA
FEMCRSENKLRQKLFAGITRPVVGRQDRITGQDTWRKRRPVLPTNKFLTK
LLEGCAYSTDNLSPSNAATLLRTNTTDVAGDSSEIPARTSPVTATPPERT
TMHATLDANAAHPSLSTNDLQQEGVKPNAEGVDEESGTNSSHISATSLHG
PPLPASVSPGINESSGLQPVRIPPVTPSQDLPQQVVQTKPASLLYRCPCK
LQDPQDPAKDLHQNCCYKSAFRLL*

MIP11264.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16720-PA 474 GF16720-PA 7..474 2..424 1382 65.8 Plus
Dana\GF18277-PA 167 GF18277-PA 9..158 33..201 257 36.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11176-PA 427 GG11176-PA 1..427 1..424 2062 90.9 Plus
Dere\GG12471-PA 165 GG12471-PA 9..158 33..201 269 37.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:49:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22376-PA 314 GH22376-PA 26..279 22..272 825 59.1 Plus
Dgri\GH18245-PA 465 GH18245-PA 15..190 40..201 324 40.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG6688-PA 424 CG6688-PA 1..424 1..424 2262 100 Plus
CG34375-PA 567 CG34375-PA 16..187 40..201 334 40.7 Plus
CG34375-PC 568 CG34375-PC 16..188 40..201 334 40.5 Plus
CG34375-PB 568 CG34375-PB 16..188 40..201 334 40.5 Plus
sinah-PC 351 CG13030-PC 100..155 138..193 155 50 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22002-PA 290 GI22002-PA 27..258 22..253 731 56.5 Plus
Dmoj\GI10770-PA 90 GI10770-PA 1..76 127..201 188 50 Plus
Dmoj\GI10769-PA 116 GI10769-PA 15..88 40..109 170 44.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL27120-PA 501 GL27120-PA 27..501 22..424 1216 57.4 Plus
Dper\GL20581-PA 150 GL20581-PA 1..76 127..201 178 48.7 Plus
Dper\GL27361-PA 129 GL27361-PA 16..89 40..109 176 44.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19782-PA 500 GA19782-PA 1..500 1..424 1220 55.6 Plus
Dpse\GA30099-PA 594 GA30099-PA 16..188 40..201 345 41 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26478-PA 451 GM26478-PA 1..403 1..404 2027 95.1 Plus
Dsec\GM23602-PA 116 GM23602-PA 16..93 40..113 177 43.6 Plus
Dsec\GM25665-PA 352 GM25665-PA 101..156 138..193 153 51.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20994-PA 424 GD20994-PA 1..424 1..424 2179 96.5 Plus
Dsim\GD18416-PA 117 GD18416-PA 16..93 40..113 174 43.6 Plus
Dsim\GD14672-PA 321 GD14672-PA 68..125 136..193 149 48.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:49:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14356-PA 252 GJ14356-PA 12..225 6..219 758 61.7 Plus
Dvir\GJ14368-PA 241 GJ14368-PA 15..188 40..201 314 40.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11484-PA 642 GK11484-PA 29..324 22..320 1065 68 Plus
Dwil\GK11612-PA 96 GK11612-PA 1..76 127..201 181 48.7 Plus
Dwil\GK11611-PA 117 GK11611-PA 16..96 40..116 171 42 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:49:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10344-PA 432 GE10344-PA 1..432 1..424 1957 88.7 Plus
Dyak\GE23996-PA 209 GE23996-PA 9..188 33..201 330 40.6 Plus

MIP11264.hyp Sequence

Translation from 100 to 1374

> MIP11264.hyp
MRKSAGGFHSTSNEDGQHGDGSSVRLLRIPRAAPAMENYGFQLTRSKWDP
YPWVCEVAAGTPAALCGLKPGDCVLEVNGNDVLGLRVSEIAKMVKSQKDC
VTILCWNSECDKDCDTNSICCAPMPTSLRRLSLVLESILRLVECPVCGVT
ISPPAMQCQNGHLLCVDCRIRSERCPVCRDFYTPRRALLAEQIFLTIANA
FEMCRSENKLRQKLFAGITRPVVGRQDRITGQDTWRKRRPVLPTNKFLTK
LLEGCAYSTDNLSPSNAATLLRTNTTDVAGDSSEIPARTSPVTATPPERT
TMHATLDANAAHPSLSTNDLQQEGVKPNAEGVDEESGTNSSHISATSLHG
PPLPASVSPGINESSGLQPVRIPPVTPSQDLPQQVVQTKPASLLYRCPCK
LQDPQDPAKDLHQNCCYKSAFRLL*

MIP11264.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:20:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG6688-PA 424 CG6688-PA 1..424 1..424 2262 100 Plus
CG34375-PA 567 CG34375-PA 16..187 40..201 334 40.7 Plus
CG34375-PC 568 CG34375-PC 16..188 40..201 334 40.5 Plus
CG34375-PB 568 CG34375-PB 16..188 40..201 334 40.5 Plus
sinah-PC 351 CG13030-PC 100..155 138..193 155 50 Plus