Clone MIP11702 Report

Search the DGRC for MIP11702

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:117
Well:2
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG15170-RA
Protein status:MIP11702.pep: gold
Sequenced Size:1751

Clone Sequence Records

MIP11702.complete Sequence

1751 bp assembled on 2009-08-11

GenBank Submission: BT099542.1

> MIP11702.complete
GTCAAAATGCGTGGACTGCAGACAAATCGCCACTCAAGCTTCCACCACCT
GCTCCTCCTTTTCCTGGTCCTCCTGAGATCAGACCGTTGTTTTGGCATTG
TTTGCTACCACTGCGATTCCATTGCCCTGCCGGAATGTTCCCAGACCCTC
GGAGAAGTGGGAGTTCTTCCCTACAAGGAGTGCGCTACCGAGCTGACGTG
TGCCATGTCCATTGTGGACTCCATTACATACCGCGGCTGCGGAGCAGAAA
CCCCCATCATCGGAGCGACTTACTCAAAGACTTGCTCAACGAACCTGTGC
AATGCGGGTGTCTATCCGCCGGGACGACTTAAGTGCCATCATTGCGCTGG
ACAGGAATGCGTGGCAGCTCCAGCATCCAAACCAAAACCCTGTCGCTATC
ATTTGGAAGAGGATCAGTGCTACACGGATGTCATAAGTTCTTCAGATGCC
TACAGAGGTTGTACCTCCGAGCAGAATCACACGCTGTCCACTTCCGCCCA
ACTGTGTGAGATCAATGGCTGCAATGAGGAGCAAGGAGCTTGGACCCAAG
TCTGCGCCACCTGCGATTCAGCAATCGGCCGGGGTTGCAAGATAGATCTC
TTTCAGGTCAACACCGGCAGGTGCAATGTTAGCTTATACGAGGAATGCCA
GCAGGATGTTCTGTTGGGTGAGCAAGAGGATAAGTACTGCTTCAGCTTTC
GCAGACTAAGCCGCGTTGTCAGAGGATGTTCTACTAAAATTCCAACAGAT
TTGGAGCCGTATGTAGAGCAATTAGAAAAGTGTAATACCAGTGACCACTG
CAACGCAGGATGCATTACGCAGCAGAAGTGTTTTACATGCAACTCCGTGG
ATCAGGAACTTTGCCGGACAAATATTACGGCTATAGCTAATAGCACTTGT
AGCTCCGCTGAGGCCTCTTCCTGTTTCTCCTGTGAGTACTCCAACTGGAG
TATTCAGCGAGGCTGTGGAGCACCGCCGGAAAATCCTCAAATCACCAAGT
GCTATGAATGCGATGAAGGCGCTGGGTGTAATAGTAAGGATTTCACCCGG
TGCTACCAATGCAGCACGGATCAAGCGGGAGCAGGCTGTGCAAATTGGGA
AAGTCCTGGCGAAATCTACATTGAAGAATGCGATGAACCGGCTGCACCAT
GTGTGGTTGTTTCCTTTAACAACGCCACCACTGCGAGAGGTTGCCAAAAA
TCGGACTTCAGCTGTGCTTCCGCAAATGTGGCCAGTTGTCGACTATGCGA
AGGAAGTTTCTGCAACAAAGGATCATTTCCGGAGGAGCGCCTCTGGTGTC
ATCAGTGTAGGGGAGTGCAGGACTGCGAGGAGATCTCCAGGGGACAAACG
GCTATGCCTTGTCCGGCTCGAGCAAATGAGCCGGAGGATCAAGAATTGGC
CTGCTTGGAGTACTTTGACATCAACAGTAAAGAAATTGTAAGAGGATGTC
GTTCCAATCCCGAGCTATACTACGAATGTCTCTTAAGGAGTAACCACTTC
GACAGTTGTCGCACTTGTCACAGTCAGGCATGCAATAATAGTCCTGGCCG
GGAATTAAGAGCCAGCTATGAGCTGGAGGCCAAGGCATTGTCCTTGTTGC
AAGGCAAGAGTTCCGCAATATCCATCAAATTTTCGAATGCAGGTTACGGA
GTTTGGTTGATCTTTAGCGTTATCTATATTGTAACTTGCTGAGACTATAA
ATAAAAGGATAGCAGAACCCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
A

MIP11702.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:29:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG15170-RA 1752 CG15170-RA 35..1752 1..1718 8590 100 Plus
CG15168-RA 570 CG15168-RA 454..570 1728..1612 540 97.4 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 20:19:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 18986962..18988466 1718..214 7450 99.7 Minus
chr2L 23010047 chr2L 18988647..18988781 214..80 660 99.3 Minus
chr2L 23010047 chr2L 18988847..18988925 79..1 365 97.5 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:19:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG15170-RA 1686 CG15170-PA 1..1686 7..1692 8430 100 Plus
CG15170-RB 1683 CG15170-PB 1..1683 7..1692 8350 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:13:13 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG15170-RA 1718 CG15170-RA 1..1718 1..1718 8590 100 Plus
CG15170-RB 1715 CG15170-RB 1..1715 1..1718 8510 99.8 Plus
CG15168-RA 492 CG15168-RA 429..492 1718..1655 320 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 20:19:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG15170-PA 561 CG15170-PA 1..561 7..1689 2878 100 Plus
CG15170-PB 560 CG15170-PB 1..560 7..1689 2860 99.6 Plus
CG15773-PA 478 CG15773-PA 33..442 103..1266 395 31 Plus
CG15773-PB 319 CG15773-PB 33..296 103..867 295 33.9 Plus
CG13492-PD 2979 CG13492-PD 782..1365 103..1542 229 21.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 20:18:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18988258..18989772 1728..214 7530 99.8 Minus
2L 23513712 2L 18989953..18990087 214..80 675 100 Minus
2L 23513712 2L 18990155..18990233 79..1 395 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18988258..18989772 1728..214 7530 99.8 Minus
2L 23513712 2L 18989953..18990087 214..80 675 100 Minus
2L 23513712 2L 18990155..18990233 79..1 395 100 Minus
Blast to na_te.dros performed on 2014-11-26 20:18:58 has no hits.

MIP11702.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:26:20 Download gff for MIP11702.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 18988847..18988925 1..79 97   Minus
chr2L 18988647..18988781 80..214 99 <- Minus
chr2L 18986960..18988465 215..1720 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:13:32 Download gff for MIP11702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15170-RA 1..1686 7..1692 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:57:44 Download gff for MIP11702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15170-RA 1..1686 7..1692 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:01:48 Download gff for MIP11702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15170-RA 1..1686 7..1692 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:26:20 Download gff for MIP11702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15170-RA 1..1686 7..1692 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-08-11 08:57:03 Download gff for MIP11702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15170-RA 1..1686 7..1692 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:57:44 Download gff for MIP11702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15170-RA 1..1718 1..1718 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:01:48 Download gff for MIP11702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15170-RA 1..1718 1..1718 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:26:20 Download gff for MIP11702.complete
Subject Subject Range Query Range Percent Splice Strand
CG15170-RA 1..1718 1..1718 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:26:20 Download gff for MIP11702.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18990155..18990233 1..79 100   Minus
2L 18989953..18990087 80..214 100 <- Minus
2L 18988266..18989771 215..1720 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:01:48 Download gff for MIP11702.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18990155..18990233 1..79 100   Minus
arm_2L 18989953..18990087 80..214 100 <- Minus
arm_2L 18988266..18989771 215..1720 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:49:19 Download gff for MIP11702.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18990155..18990233 1..79 100   Minus
2L 18989953..18990087 80..214 100 <- Minus
2L 18988266..18989771 215..1720 99 <- Minus

MIP11702.pep Sequence

Translation from 0 to 1691

> MIP11702.pep
VKMRGLQTNRHSSFHHLLLLFLVLLRSDRCFGIVCYHCDSIALPECSQTL
GEVGVLPYKECATELTCAMSIVDSITYRGCGAETPIIGATYSKTCSTNLC
NAGVYPPGRLKCHHCAGQECVAAPASKPKPCRYHLEEDQCYTDVISSSDA
YRGCTSEQNHTLSTSAQLCEINGCNEEQGAWTQVCATCDSAIGRGCKIDL
FQVNTGRCNVSLYEECQQDVLLGEQEDKYCFSFRRLSRVVRGCSTKIPTD
LEPYVEQLEKCNTSDHCNAGCITQQKCFTCNSVDQELCRTNITAIANSTC
SSAEASSCFSCEYSNWSIQRGCGAPPENPQITKCYECDEGAGCNSKDFTR
CYQCSTDQAGAGCANWESPGEIYIEECDEPAAPCVVVSFNNATTARGCQK
SDFSCASANVASCRLCEGSFCNKGSFPEERLWCHQCRGVQDCEEISRGQT
AMPCPARANEPEDQELACLEYFDINSKEIVRGCRSNPELYYECLLRSNHF
DSCRTCHSQACNNSPGRELRASYELEAKALSLLQGKSSAISIKFSNAGYG
VWLIFSVIYIVTC*

MIP11702.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:45:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14642-PA 549 GF14642-PA 1..548 3..562 2238 74.5 Plus
Dana\GF20801-PA 472 GF20801-PA 30..430 32..422 299 30 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:45:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21666-PA 300 GG21666-PA 1..250 3..253 1082 82.9 Plus
Dere\GG18779-PA 464 GG18779-PA 19..430 17..424 338 32.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11597-PA 523 GH11597-PA 23..511 31..521 1570 60.6 Plus
Dgri\GH24088-PA 464 GH24088-PA 15..421 18..422 307 30.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:45:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG15170-PA 561 CG15170-PA 1..561 3..563 3106 100 Plus
CG15170-PB 560 CG15170-PB 1..560 3..563 3082 99.6 Plus
CG15773-PA 478 CG15773-PA 33..442 35..422 431 31.7 Plus
CG15773-PB 319 CG15773-PB 33..317 35..312 312 33.3 Plus
CG13492-PD 2979 CG13492-PD 763..1365 23..514 263 22 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17166-PA 561 GI17166-PA 34..534 32..534 1756 63.2 Plus
Dmoj\GI15900-PA 462 GI15900-PA 3..416 13..422 337 30.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19620-PA 548 GL19620-PA 1..545 17..562 2054 67.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13547-PA 548 GA13547-PA 1..545 17..562 2037 67.6 Plus
Dpse\GA13948-PA 549 GA13948-PA 104..517 13..422 317 30.2 Plus
Dpse\GA26036-PA 81 GA26036-PA 9..56 25..74 179 70 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17044-PA 558 GM17044-PA 1..558 3..562 2675 92.5 Plus
Dsec\GM12431-PA 453 GM12431-PA 210..419 211..424 173 32.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:45:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21792-PA 559 GD21792-PA 1..559 3..562 2674 92 Plus
Dsim\GD16746-PA 465 GD16746-PA 30..431 33..424 334 32.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:45:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17671-PA 553 GJ17671-PA 26..550 32..562 1731 59.9 Plus
Dvir\GJ16648-PA 456 GJ16648-PA 28..421 35..424 341 31.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23785-PA 532 GK23785-PA 10..532 14..541 1825 63.3 Plus
Dwil\GK24922-PA 471 GK24922-PA 20..430 23..423 350 31.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12686-PA 409 GE12686-PA 67..400 147..480 1568 87.4 Plus
Dyak\GE16424-PA 464 GE16424-PA 20..428 17..424 342 31.3 Plus
Dyak\GE12686-PA 409 GE12686-PA 1..95 3..101 259 64.6 Plus

MIP11702.hyp Sequence

Translation from 0 to 1691

> MIP11702.hyp
VKMRGLQTNRHSSFHHLLLLFLVLLRSDRCFGIVCYHCDSIALPECSQTL
GEVGVLPYKECATELTCAMSIVDSITYRGCGAETPIIGATYSKTCSTNLC
NAGVYPPGRLKCHHCAGQECVAAPASKPKPCRYHLEEDQCYTDVISSSDA
YRGCTSEQNHTLSTSAQLCEINGCNEEQGAWTQVCATCDSAIGRGCKIDL
FQVNTGRCNVSLYEECQQDVLLGEQEDKYCFSFRRLSRVVRGCSTKIPTD
LEPYVEQLEKCNTSDHCNAGCITQQKCFTCNSVDQELCRTNITAIANSTC
SSAEASSCFSCEYSNWSIQRGCGAPPENPQITKCYECDEGAGCNSKDFTR
CYQCSTDQAGAGCANWESPGEIYIEECDEPAAPCVVVSFNNATTARGCQK
SDFSCASANVASCRLCEGSFCNKGSFPEERLWCHQCRGVQDCEEISRGQT
AMPCPARANEPEDQELACLEYFDINSKEIVRGCRSNPELYYECLLRSNHF
DSCRTCHSQACNNSPGRELRASYELEAKALSLLQGKSSAISIKFSNAGYG
VWLIFSVIYIVTC*

MIP11702.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG15170-PA 561 CG15170-PA 1..561 3..563 3106 100 Plus
CG15170-PB 560 CG15170-PB 1..560 3..563 3082 99.6 Plus
CG15773-PA 478 CG15773-PA 33..442 35..422 431 31.7 Plus
CG15773-PB 319 CG15773-PB 33..317 35..312 312 33.3 Plus
CG13492-PD 2979 CG13492-PD 763..1365 23..514 263 22 Plus