Clone MIP11944 Report

Search the DGRC for MIP11944

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:119
Well:44
Vector:pOTB7_DraIII
Associated Gene/TranscriptCG9203-RA
Protein status:MIP11944.pep: gold
Sequenced Size:2383

Clone Sequence Records

MIP11944.complete Sequence

2383 bp assembled on 2009-06-26

GenBank Submission: BT088892.1

> MIP11944.complete
ATTTTTCGAAGTATTTTTGTGCACCTCGAAATTGCGATACTAATTTCTGT
AGAGGATTGGCCCAGGATCAACAAGGCGACCATCATGTCAGATGCAGACT
ACTTGTTCGCTCTGAACCTGCAGAACCAGCTAAATGCGGAGTCAGACCAA
AGTTACACAGCCGCGGATGCCAGCAATGACAGGGACTATCAGCTGGCACG
CAGGATTCAGAACCTAATAAACGAGGGCGATGAGGACGGTGCTAGCGAGC
TGGACAGCAGCATTCAGTTCGTCTACCCCAAATCGAATCAGCCAAAATCA
ACAAAAATGGAGAACTCTGAAATCAAAAACAAAAAACGAGAAGCGGCTAA
AAAGAAGCCAGTGCGCGCTATTCAGGCCAGCCATGATGACTATCTGAATA
AGACGATGAATCTGGTGGATCCGGAGTGGGAGCTGGTCGATCCCACCCCG
GACATCTACGCCATGTTCATACGCTTCGACGAGAAGTTCTTCCAGGAGCG
CCTGGGCGCCGTCTCCCTGGAATGGAGCAAGAAGATGTACTCGTGCGCTG
GAATCTGCTACCAGCGTGGCAATCGCTTCGTCAAACAGGTGACCATTCGG
CTCAGTGAGCCGCTGCTAAAGTTGCGTCCGCGCAAGGATCTCGTGGAAAC
GCTCTTGCACGAAATGATCCATGCCTACTGCTTTGTGCTCAATATACGCG
AGGGTAACGGTGGCCATGGACCCAATTTCAAGCGCATCATGGAGACGATC
AATAAGGTGGCGGGCACCAACATCACCGTTTACCACACTTTTCACGATGA
GGTGGCCTCCTATCGCACCCACATCTGGCGCTGCACGGGCATTTGCCGAG
AGCGCTCACCCTTTTGGGGCTATGTGAAGCGGACCAGCAACCGAGCGCCC
GGTCCGAACGATCAGTGGTGGAAGATGCATCAACGTGAGTGCAGCGGCAC
CTTTTTGAAGTTGAGTGAACCCCCGAAGGCCCCCAAGCCGGAGACCAAGT
CAAGGGCTAAGAAGTCCACACCGGCGGTGGCCGCGCCCAAGGAAGACATA
CGCAACTGGTTCGGCCAGCCGTCAGCCAAGAAAGCGGCCACCGGCACAGT
CTTACTAGGCGATCTGGCGAAGGCGGTGCCGCCGACTTCTTATCCCGGAC
TCTCTTCCGAACCCTTTGCATTGCCCAAGACACCAGCTGCTGGCACAAAA
GGCAACAAAAGCGGCGGATTCAATGAACTGGACAAATCAGGTTCGAAAGC
CACCACTGAAATGAGCGGACAGGGCTACAGTCTTGGTGGCTCTAGCGCTA
TAGAACACATAGATCTTAGTGACACTGATGTTCCCGATTCCGCTAAACTT
CGTCAAATTCGACTTCAGCGTTTTAGCGAAGATGCTTCCAACAAGCGACA
GAATAAGAAAAAGAGGCGTCGTGTTTCCAGCGACAGCGAGATAATCAACT
GGGAGTCCTACGATGATGACGTAATGGTCAGGGATGTTCATACGCCCATC
GTCAACTTGGTCGAAAGCTCTAGTGATGAAGAGGAGATGAAGATGCCAGC
TGGCAGAAAAACCATGACCAGTCAGGAGCGCACGCAGATCATCAAGCGCC
AGGTAATGGAGGATGAGTTGACCTTGTGTGAGGACGATATCCTCTTAATT
GATGATGAATACGACGATGAGGTGGCCGCAAATGAATCTTTAACAGCCGC
CACGGAGCTAGCTGACCAATCCATTATAGATGATATTTTTGGAGAGGACA
CCCTGCTGAAGGAGTTCCAGCGTGAGAACGACGTGCAGCCCAGTTGCTCA
AGCTACGCCAAAAGAATTGAGAACGACATCGTATCTTGTCCCATTTGCTT
TGAGAAAATGAGGCGCACTGAGTTGTCCAATCACTTCGATGGCTGCGCCA
TTATGGTGCGCTTGGAACCGCCATCGTTTAAGCCTAAAAACCGCCGAACA
ACTGCTTCCTTAACCTCAAAGGACTCGTCGGGAGCTTCCACATCACGCCG
CGCTAAATCGAAAGCAAAGTCATCAAAAGGAATTCTTCGCAGCTCCGGTT
ACACAGAAGGGGAGATCGACAAGCTCAACCTGAGCTCCTCTACCGACTCG
TCTACTCTGCCGTCTAGCGAGGACGAACTTACTCCGCGTCAGCGCCGCCA
GCGCAACCTCTTCAAAGAGACCGTAGGCTGCCCCAGATGTGGCCTGGAGA
TCATGCCTCTACACCTGAAGGTCCATGGATCCGTCTGCGCTGGTCGCAAG
AAGCGCTAGGACAAAAAACATCTCATACAAAACATAATTCGTTAAATAGA
AACTAATGTTAACTTTAATGTTATTAAAAACATGTTACAGGATTCGCCCA
AAAAAAGAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP11944.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:32:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG9203-RA 2382 CG9203-RA 34..2382 1..2349 11745 100 Plus
CG14033-RA 1533 CG14033-RA 1239..1405 2096..2262 415 83.2 Plus
CG14033-RA 1533 CG14033-RA 782..900 1540..1658 355 86.5 Plus
CG14033-RA 1533 CG14033-RA 897..1032 1667..1801 355 85.2 Plus
CG6308-RA 696 CG6308-RA 637..696 2353..2294 300 100 Minus
CG14033-RA 1533 CG14033-RA 1144..1227 1974..2057 285 89.2 Plus
CG14033-RA 1533 CG14033-RA 1034..1078 1822..1866 210 97.7 Plus
CG14033-RA 1533 CG14033-RA 1083..1115 1898..1930 150 96.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15362748..15364444 2353..657 8455 99.9 Minus
chrX 22417052 chrX 15364551..15364907 657..301 1785 100 Minus
chrX 22417052 chrX 15365171..15365348 178..1 890 100 Minus
chrX 22417052 chrX 15364987..15365109 300..178 615 100 Minus
chr2L 23010047 chr2L 5242588..5242838 1540..1801 525 81.7 Plus
chr2L 23010047 chr2L 5243045..5243211 2096..2262 415 83.2 Plus
chr2L 23010047 chr2L 5242950..5243033 1974..2057 285 89.3 Plus
chr2L 23010047 chr2L 5242840..5242884 1822..1866 210 97.8 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:42:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG9203-RA 2175 CG9203-PA 1..2175 85..2259 10875 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:13:21 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:42:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG9203-RA 2349 CG9203-RA 1..2349 1..2349 11745 100 Plus
CG6308-RA 696 CG6308-RA 637..696 2353..2294 300 100 Minus
tkv-RC 2885 CG14026-RC 29..160 2262..2131 285 81.1 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG9203-PA 724 CG9203-PA 1..724 85..2256 3242 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:42:29
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15472800..15474496 2353..657 8485 100 Minus
X 23542271 X 15474603..15474959 657..301 1785 100 Minus
X 23542271 X 15475223..15475400 178..1 890 100 Minus
X 23542271 X 15475039..15475161 300..178 615 100 Minus
2L 23513712 2L 5243488..5243738 1540..1801 525 81.7 Plus
2L 23513712 2L 5243945..5244111 2096..2262 415 83.2 Plus
2L 23513712 2L 5243850..5243933 1974..2057 285 89.3 Plus
2L 23513712 2L 5243740..5243784 1822..1866 210 97.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15480898..15482594 2353..657 8485 100 Minus
X 23527363 X 15482701..15483057 657..301 1785 100 Minus
X 23527363 X 15483321..15483498 178..1 890 100 Minus
X 23527363 X 15483137..15483259 300..178 615 100 Minus
2L 23513712 2L 5243945..5244111 2096..2262 415 83.2 Plus
2L 23513712 2L 5243488..5243606 1540..1658 355 86.5 Plus
2L 23513712 2L 5243603..5243738 1667..1801 355 85.2 Plus
2L 23513712 2L 5243850..5243933 1974..2057 285 89.2 Plus
2L 23513712 2L 5243740..5243784 1822..1866 210 97.7 Plus
2L 23513712 2L 5243789..5243821 1898..1930 150 96.9 Plus
Blast to na_te.dros performed on 2014-11-27 07:42:30 has no hits.

MIP11944.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:49:38 Download gff for MIP11944.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15365172..15365348 1..177 100   Minus
chrX 15364987..15365109 178..300 100 <- Minus
chrX 15364551..15364907 301..657 100 <- Minus
chrX 15362743..15364443 658..2357 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:11:17 Download gff for MIP11944.complete
Subject Subject Range Query Range Percent Splice Strand
CG9203-RA 1..2175 85..2259 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:49:10 Download gff for MIP11944.complete
Subject Subject Range Query Range Percent Splice Strand
CG9203-RA 1..2175 85..2259 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:34:47 Download gff for MIP11944.complete
Subject Subject Range Query Range Percent Splice Strand
CG9203-RA 1..2175 85..2259 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:49:38 Download gff for MIP11944.complete
Subject Subject Range Query Range Percent Splice Strand
CG9203-RA 1..2175 85..2259 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-30 13:55:09 Download gff for MIP11944.complete
Subject Subject Range Query Range Percent Splice Strand
CG9203-RA 1..2236 24..2259 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:49:10 Download gff for MIP11944.complete
Subject Subject Range Query Range Percent Splice Strand
CG9203-RA 1..2236 24..2259 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:34:47 Download gff for MIP11944.complete
Subject Subject Range Query Range Percent Splice Strand
CG9203-RA 1..2349 1..2349 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:49:38 Download gff for MIP11944.complete
Subject Subject Range Query Range Percent Splice Strand
CG9203-RA 1..2349 1..2349 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:49:38 Download gff for MIP11944.complete
Subject Subject Range Query Range Percent Splice Strand
X 15475224..15475400 1..177 100   Minus
X 15475039..15475161 178..300 100 <- Minus
X 15474603..15474959 301..657 100 <- Minus
X 15472795..15474495 658..2357 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:34:47 Download gff for MIP11944.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15369257..15369433 1..177 100   Minus
arm_X 15369072..15369194 178..300 100 <- Minus
arm_X 15368636..15368992 301..657 100 <- Minus
arm_X 15366828..15368528 658..2357 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:24:52 Download gff for MIP11944.complete
Subject Subject Range Query Range Percent Splice Strand
X 15483322..15483498 1..177 100   Minus
X 15483137..15483259 178..300 100 <- Minus
X 15482701..15483057 301..657 100 <- Minus
X 15480893..15482593 658..2357 99 <- Minus

MIP11944.pep Sequence

Translation from 0 to 2258

> MIP11944.pep
IFRSIFVHLEIAILISVEDWPRINKATIMSDADYLFALNLQNQLNAESDQ
SYTAADASNDRDYQLARRIQNLINEGDEDGASELDSSIQFVYPKSNQPKS
TKMENSEIKNKKREAAKKKPVRAIQASHDDYLNKTMNLVDPEWELVDPTP
DIYAMFIRFDEKFFQERLGAVSLEWSKKMYSCAGICYQRGNRFVKQVTIR
LSEPLLKLRPRKDLVETLLHEMIHAYCFVLNIREGNGGHGPNFKRIMETI
NKVAGTNITVYHTFHDEVASYRTHIWRCTGICRERSPFWGYVKRTSNRAP
GPNDQWWKMHQRECSGTFLKLSEPPKAPKPETKSRAKKSTPAVAAPKEDI
RNWFGQPSAKKAATGTVLLGDLAKAVPPTSYPGLSSEPFALPKTPAAGTK
GNKSGGFNELDKSGSKATTEMSGQGYSLGGSSAIEHIDLSDTDVPDSAKL
RQIRLQRFSEDASNKRQNKKKRRRVSSDSEIINWESYDDDVMVRDVHTPI
VNLVESSSDEEEMKMPAGRKTMTSQERTQIIKRQVMEDELTLCEDDILLI
DDEYDDEVAANESLTAATELADQSIIDDIFGEDTLLKEFQRENDVQPSCS
SYAKRIENDIVSCPICFEKMRRTELSNHFDGCAIMVRLEPPSFKPKNRRT
TASLTSKDSSGASTSRRAKSKAKSSKGILRSSGYTEGEIDKLNLSSSTDS
STLPSSEDELTPRQRRQRNLFKETVGCPRCGLEIMPLHLKVHGSVCAGRK
KR*

MIP11944.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:42:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22256-PA 814 GF22256-PA 4..814 31..752 1756 46.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:42:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19397-PA 752 GG19397-PA 1..752 29..752 2863 74.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:42:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12438-PA 720 GH12438-PA 4..720 31..752 1701 48.3 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:42:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG9203-PA 724 CG9203-PA 1..724 29..752 3774 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:42:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21791-PA 790 GI21791-PA 4..786 31..746 1775 50.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:42:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13306-PA 752 GL13306-PA 4..752 31..752 1890 51.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:42:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21609-PA 752 GA21609-PA 4..752 31..752 1886 51.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19503-PA 1334 GM19503-PA 622..1267 54..692 2976 87.8 Plus
Dsec\GM19514-PA 133 GM19514-PA 1..133 620..752 539 87.2 Plus
Dsec\GM12081-PA 124 GM12081-PA 1..113 103..214 528 87.6 Plus
Dsec\GM18541-PA 89 GM18541-PA 16..88 678..751 186 68.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24499-PA 237 GD24499-PA 1..237 515..752 994 80.7 Plus
Dsim\GD19487-PA 112 GD19487-PA 1..110 522..630 364 67.3 Plus
Dsim\GD19476-PA 125 GD19476-PA 12..124 510..631 338 62.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16963-PA 773 GJ16963-PA 4..773 31..752 1719 49.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:42:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25476-PA 851 GK25476-PA 1..847 29..751 1927 48.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16043-PA 754 GE16043-PA 1..754 29..752 2874 74.2 Plus

MIP11944.hyp Sequence

Translation from 0 to 2258

> MIP11944.hyp
IFRSIFVHLEIAILISVEDWPRINKATIMSDADYLFALNLQNQLNAESDQ
SYTAADASNDRDYQLARRIQNLINEGDEDGASELDSSIQFVYPKSNQPKS
TKMENSEIKNKKREAAKKKPVRAIQASHDDYLNKTMNLVDPEWELVDPTP
DIYAMFIRFDEKFFQERLGAVSLEWSKKMYSCAGICYQRGNRFVKQVTIR
LSEPLLKLRPRKDLVETLLHEMIHAYCFVLNIREGNGGHGPNFKRIMETI
NKVAGTNITVYHTFHDEVASYRTHIWRCTGICRERSPFWGYVKRTSNRAP
GPNDQWWKMHQRECSGTFLKLSEPPKAPKPETKSRAKKSTPAVAAPKEDI
RNWFGQPSAKKAATGTVLLGDLAKAVPPTSYPGLSSEPFALPKTPAAGTK
GNKSGGFNELDKSGSKATTEMSGQGYSLGGSSAIEHIDLSDTDVPDSAKL
RQIRLQRFSEDASNKRQNKKKRRRVSSDSEIINWESYDDDVMVRDVHTPI
VNLVESSSDEEEMKMPAGRKTMTSQERTQIIKRQVMEDELTLCEDDILLI
DDEYDDEVAANESLTAATELADQSIIDDIFGEDTLLKEFQRENDVQPSCS
SYAKRIENDIVSCPICFEKMRRTELSNHFDGCAIMVRLEPPSFKPKNRRT
TASLTSKDSSGASTSRRAKSKAKSSKGILRSSGYTEGEIDKLNLSSSTDS
STLPSSEDELTPRQRRQRNLFKETVGCPRCGLEIMPLHLKVHGSVCAGRK
KR*

MIP11944.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG9203-PA 724 CG9203-PA 1..724 29..752 3774 100 Plus