Clone MIP12509 Report

Search the DGRC for MIP12509

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:125
Well:9
Vector:pOTB7_DraIII
Associated Gene/Transcriptkar-RB
Protein status:MIP12509.pep: gold
Sequenced Size:2349

Clone Sequence Records

MIP12509.complete Sequence

2349 bp assembled on 2009-09-22

GenBank Submission: BT099794.1

> MIP12509.complete
ATTCCGCCGCCGACGACGCAAGCGTTCGGTTGTGTGCTCGCTCGAGAGGT
CTCCACCCGACCACTGATTCCCGCGATTCTCGAGTCGGCTTCATCTGATT
CCCAGAGTCTTCAAGTGAATCGCACGTCTGCCTGCAGCGACTGGAGTTCC
GGCTTACAAGCAGCACTCCGAATCCAATCCTAGCCAGCAGCCATGGCTGA
GAATGAACCGCTGAACGACCTGCAGAGCCAGGTGAATGGTCGTATCCTGC
CCGCCGCCAATGGACATACAGCATCCGCGACCAACGGATTGGTGCATGCG
AATGGCAAGGATGCAATGAAGCCGTCAGCTCCCGTTCAGAATGGGAATGG
CAACGCGAACGGGACACACATCGAGGCGCCCTGCTGTCGGGACATACACG
GCAAGGAGCCACCGGACGGAGGAGCACGCGCCTGGCTGGTCATGGTGAGC
GCCTTCCTTTGCAACGGCATCATCTTTGGGTTCATCAACACCTACGGCGT
TATCCATTCGCTGCTGACGGATAGGCTTACGAAGCTCGGCGATCCGGAGG
CGTCCAGCAAAGCGGCTCTGATTGGCGCCCTGGCCATCGGCACCACATTC
CTCTTCTCCACAATGGCTGGCTGTCTGACGGACAAGATTGGCCTGCGGCT
GACCACGTTCGCCGGCGGAGTCCTCTCCGCGGGAGGACTGCTGCTGTCCT
CGTTTTGCACGGAGAACATCGGCGCCCTGTACTTCACCTACGGGATCATG
TTCGGCCTGGGTGCCGCCCTTGCCTACACGCCCACATTGGCCATCCTGGG
CCACTATTTCAAGCGGTACCTGGGAAAGGTGAGTGGCTTTGTGACCGCCG
GCTCCAGCGTTTTCACTGTGATACTGCCGCCCTGTCTGGACAAGCTGCTC
GGTAGCTATGGTCTGGAGGGGACCCTGCGGATAATGAGCCTCGTTTCCGC
CTTTATTATCCTTTGCTCCTTCGTGTACAAGCCACTGCATCCGCCACCGG
AGCCGCCGAAGAAGAAGCCCGGCAGATCGCGCATCAATCTCTTCCTACGC
TCGATCATCAACGTGGAGATCTGGAAGCGTAAACGCTTCGTCATCTGGGC
ACTTTGTGTGCCGCTCGCCTTGTTCGGCTACTTTGTGCCCTATGTGCACA
TGATGCAGTTCGTGAAAACCACTTTTCCGGGAGAGGATGTCAACCTGCCG
GTCATGTGTATCGGCATCACCTCCGGCATCGGGCGTCTGATTTTCGGAGT
CATTGCCGATATGCCGGGTGTGAACCGTATGTACCTGCAACAATTGTCCT
TGGTGTCCATTGGCCTGGTTACCTTGCTGCTGCCGCTCACCAACTCGTAC
GTCATCCTCGTCTCGTTCACCCTGGTCATGGGTCTTTTCGACGGCTGCTT
CATTTCGCTGCTGGGCCCAATAGCCTACGAGATCTGTGGCCCCTCGGGCG
CCACACAGGCCATCGGCTTTCTGCTAGGACTCAGTTCTATTCCGCTCACA
GTGGGTCCACCAGTGGCGGGCATGATCTTCGACAGCACGAACTCCTACAC
ATTGCCGCTGATCCTCGCCGGACTCCCCCCACTACTTGGCTCCTCGCTCT
TGTTCCTCATCAAGTGCGTCAAGGAGGAGGAGAACGGGGTCAGTGCGCCG
CGAGCGGTGGTACTGGCCAATGGAGACATCGAGATTGCCGGCAACGGCCA
TTATCGGTCGGCTGGCACCAAGTCCAGTGCACCGCTGATGGGTGCCACGA
ATGGTATCAATGGAAGCGCACCAGCGTCCCCAACTATCCAGAGCAATGGA
CACGTGGACAACGGAACTGGTTCGTACCCCGACTCACCTTGGCCTAGCCC
CACTCGCATCTCAGACTCCGCCGCCTGCGACCATTCCAGTAGCTCGCTTC
ACACTAACCCGGGCACCCTGCTGCCCAGCTGCTCGCACACCGCCCTGCTG
AGCGGGCGCTCTGGCTCCAGCAAGTCCCTGCCCCTGGGCGACGAACCCAA
GAGGCGTCGCTATAACTACTCCATCTACTAACCCACTCACTCACTCACTG
CCTAGTTGCTAGCTGCTAGAGCTTCTCTGCTTCGCCTGCCGTACTCTGCC
TTTCTGGTGTGGATCGAGTTTGTAATCGAATAGCATGACTAAGACGCACT
TCTGTTCAATCCACATTCCGAGCACCTTGTCTCTAACCCTGCACCTGCAT
ACCCATCACACCTAAACCCCTAAAACCCATTCCCTTCCTATAGACCCCGA
TTGCTTTGTAGATCGTAAGGCTCATCGACTTGGAACCGCTGTAAATAAAT
GCCAGCTTATGTCGCATACTCAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP12509.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:49:03
Subject Length Description Subject Range Query Range Score Percent Strand
kar-RA 2491 kar-RA 310..2129 1..1820 9100 100 Plus
kar.a 2464 kar.a 284..2103 1..1820 9100 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:53:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 8508547..8509332 1715..930 3930 100 Minus
chr3R 27901430 chr3R 8507868..8508475 2320..1714 2990 99.8 Minus
chr3R 27901430 chr3R 8512957..8513362 565..160 2015 99.8 Minus
chr3R 27901430 chr3R 8509387..8509756 934..565 1835 99.7 Minus
chr3R 27901430 chr3R 8514450..8514609 160..1 800 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:53:40
Subject Length Description Subject Range Query Range Score Percent Strand
kar-RB 1839 CG12286-PB 1..1839 193..2031 9195 100 Plus
kar-RA 1662 CG12286-PA 1..1628 193..1820 8140 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:13:38 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:53:38
Subject Length Description Subject Range Query Range Score Percent Strand
kar-RB 2321 CG12286-RB 1..2321 1..2320 11555 100 Plus
kar-RA 2176 CG12286-RA 1..1820 1..1820 9100 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:53:44
Subject Length Description Subject Range Query Range Score Percent Strand
kar-PB 612 CG12286-PB 1..612 193..2028 2734 100 Plus
kar-PA 553 CG12286-PA 1..543 193..1821 2520 100 Plus
CG11665-PB 658 CG11665-PB 8..231 301..978 238 33.3 Plus
CG11665-PA 658 CG11665-PA 8..231 301..978 238 33.3 Plus
Mct1-PB 626 CG3456-PB 417..582 1054..1548 230 29.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12683314..12684099 1715..930 3930 100 Minus
3R 32079331 3R 12682635..12683242 2320..1714 2990 99.8 Minus
3R 32079331 3R 12687716..12688121 565..160 2030 100 Minus
3R 32079331 3R 12684154..12684523 934..565 1835 99.7 Minus
3R 32079331 3R 12689208..12689367 160..1 800 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 12424145..12424930 1715..930 3930 100 Minus
3R 31820162 3R 12423466..12424073 2320..1714 3000 99.8 Minus
3R 31820162 3R 12428547..12428952 565..160 2030 100 Minus
3R 31820162 3R 12424985..12425354 934..565 1835 99.7 Minus
3R 31820162 3R 12430039..12430198 160..1 800 100 Minus
Blast to na_te.dros performed on 2014-11-27 02:53:38 has no hits.

MIP12509.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:25:43 Download gff for MIP12509.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 8514451..8514609 1..159 100   Minus
chr3R 8512957..8513362 160..565 99 <- Minus
chr3R 8509391..8509755 566..930 100 <- Minus
chr3R 8508548..8509331 931..1714 100 <- Minus
chr3R 8507866..8508474 1715..2321 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:54:55 Download gff for MIP12509.complete
Subject Subject Range Query Range Percent Splice Strand
kar-RA 1..1628 193..1820 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:32:20 Download gff for MIP12509.complete
Subject Subject Range Query Range Percent Splice Strand
kar-RB 1..1839 193..2031 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:54:15 Download gff for MIP12509.complete
Subject Subject Range Query Range Percent Splice Strand
kar-RB 1..1839 193..2031 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:25:43 Download gff for MIP12509.complete
Subject Subject Range Query Range Percent Splice Strand
kar-RB 1..1839 193..2031 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-22 09:10:44 Download gff for MIP12509.complete
Subject Subject Range Query Range Percent Splice Strand
kar-RA 1..1820 1..1820 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:32:20 Download gff for MIP12509.complete
Subject Subject Range Query Range Percent Splice Strand
kar-RB 1..2321 1..2320 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:54:15 Download gff for MIP12509.complete
Subject Subject Range Query Range Percent Splice Strand
kar-RB 1..2321 1..2320 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:25:43 Download gff for MIP12509.complete
Subject Subject Range Query Range Percent Splice Strand
kar-RB 1..2321 1..2320 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:25:43 Download gff for MIP12509.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12689209..12689367 1..159 100   Minus
3R 12687716..12688121 160..565 100 <- Minus
3R 12684158..12684522 566..930 100 <- Minus
3R 12683315..12684098 931..1714 100 <- Minus
3R 12682633..12683241 1715..2321 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:54:15 Download gff for MIP12509.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8514931..8515089 1..159 100   Minus
arm_3R 8513438..8513843 160..565 100 <- Minus
arm_3R 8509880..8510244 566..930 100 <- Minus
arm_3R 8509037..8509820 931..1714 100 <- Minus
arm_3R 8508355..8508963 1715..2321 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:16:52 Download gff for MIP12509.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12430040..12430198 1..159 100   Minus
3R 12428547..12428952 160..565 100 <- Minus
3R 12424989..12425353 566..930 100 <- Minus
3R 12424146..12424929 931..1714 100 <- Minus
3R 12423464..12424072 1715..2321 99 <- Minus

MIP12509.pep Sequence

Translation from 192 to 2030

> MIP12509.pep
MAENEPLNDLQSQVNGRILPAANGHTASATNGLVHANGKDAMKPSAPVQN
GNGNANGTHIEAPCCRDIHGKEPPDGGARAWLVMVSAFLCNGIIFGFINT
YGVIHSLLTDRLTKLGDPEASSKAALIGALAIGTTFLFSTMAGCLTDKIG
LRLTTFAGGVLSAGGLLLSSFCTENIGALYFTYGIMFGLGAALAYTPTLA
ILGHYFKRYLGKVSGFVTAGSSVFTVILPPCLDKLLGSYGLEGTLRIMSL
VSAFIILCSFVYKPLHPPPEPPKKKPGRSRINLFLRSIINVEIWKRKRFV
IWALCVPLALFGYFVPYVHMMQFVKTTFPGEDVNLPVMCIGITSGIGRLI
FGVIADMPGVNRMYLQQLSLVSIGLVTLLLPLTNSYVILVSFTLVMGLFD
GCFISLLGPIAYEICGPSGATQAIGFLLGLSSIPLTVGPPVAGMIFDSTN
SYTLPLILAGLPPLLGSSLLFLIKCVKEEENGVSAPRAVVLANGDIEIAG
NGHYRSAGTKSSAPLMGATNGINGSAPASPTIQSNGHVDNGTGSYPDSPW
PSPTRISDSAACDHSSSSLHTNPGTLLPSCSHTALLSGRSGSSKSLPLGD
EPKRRRYNYSIY*

MIP12509.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:27:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17875-PA 610 GF17875-PA 1..610 1..612 2597 87.5 Plus
Dana\GF22732-PA 657 GF22732-PA 27..235 50..266 256 33.3 Plus
Dana\GF15251-PA 1172 GF15251-PA 440..833 74..452 256 24.3 Plus
Dana\Mct1-PA 636 GF22203-PA 426..613 287..473 232 28.7 Plus
Dana\GF10083-PA 826 GF10083-PA 564..762 281..478 211 27.1 Plus
Dana\Mct1-PA 636 GF22203-PA 19..228 61..276 177 25.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:27:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17106-PA 550 GG17106-PA 1..541 1..544 2566 97.1 Plus
Dere\GG10853-PA 656 GG10853-PA 8..235 37..266 265 31.9 Plus
Dere\GG24964-PA 1120 GG24964-PA 402..795 74..452 249 24.3 Plus
Dere\GG12920-PA 626 GG12920-PA 416..618 287..488 245 28.1 Plus
Dere\GG14631-PA 816 GG14631-PA 554..752 281..478 214 29.4 Plus
Dere\GG12920-PA 626 GG12920-PA 18..231 64..281 191 26.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19581-PA 642 GH19581-PA 1..642 1..612 2159 68 Plus
Dgri\GH13504-PA 664 GH13504-PA 52..238 73..266 239 33.5 Plus
Dgri\GH13704-PA 1121 GH13704-PA 393..786 74..452 233 24 Plus
Dgri\GH12442-PA 638 GH12442-PA 428..615 287..473 230 29.3 Plus
Dgri\GH21849-PA 681 GH21849-PA 49..236 73..267 230 31 Plus
Dgri\GH12442-PA 638 GH12442-PA 41..242 73..281 196 27.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:27:26
Subject Length Description Subject Range Query Range Score Percent Strand
kar-PB 612 CG12286-PB 1..612 1..612 3186 100 Plus
kar-PA 553 CG12286-PA 1..543 1..543 2813 100 Plus
CG11665-PB 658 CG11665-PB 8..234 37..265 285 33.3 Plus
CG11665-PA 658 CG11665-PA 8..234 37..265 285 33.3 Plus
Mct1-PB 626 CG3456-PB 417..603 288..473 250 28.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:27:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22265-PA 567 GI22265-PA 1..564 1..559 2057 71.1 Plus
Dmoj\GI21795-PA 426 GI21795-PA 39..403 73..473 315 26.1 Plus
Dmoj\GI10224-PA 656 GI10224-PA 50..236 73..266 246 33.5 Plus
Dmoj\GI23919-PA 1179 GI23919-PA 437..830 74..452 241 24.3 Plus
Dmoj\GI19091-PA 683 GI19091-PA 44..231 73..267 210 28.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:27:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23116-PA 553 GL23116-PA 1..542 1..542 2324 86.5 Plus
Dper\GL18673-PA 1133 GL18673-PA 406..799 74..452 248 24.5 Plus
Dper\GL21167-PA 653 GL21167-PA 11..233 35..266 247 29.8 Plus
Dper\GL13330-PA 213 GL13330-PA 1..187 288..473 214 27.8 Plus
Dper\GL16954-PA 817 GL16954-PA 550..744 285..478 213 28.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:27:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11533-PA 553 GA11533-PA 1..542 1..542 2333 86.8 Plus
Dpse\GA11129-PA 653 GA11129-PA 11..233 35..266 251 30.2 Plus
Dpse\GA10013-PA 1142 GA10013-PA 403..796 74..452 249 24.5 Plus
Dpse\GA17462-PA 637 GA17462-PA 424..611 287..473 225 27.7 Plus
Dpse\GA12617-PA 817 GA12617-PA 550..744 285..478 213 28.7 Plus
Dpse\GA17462-PA 637 GA17462-PA 30..233 73..281 197 27 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:27:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25990-PA 553 GM25990-PA 1..544 1..544 2613 97.8 Plus
Dsec\GM16505-PA 658 GM16505-PA 8..235 37..266 282 32.9 Plus
Dsec\GM18432-PA 1115 GM18432-PA 400..793 74..452 249 24.5 Plus
Dsec\GM19211-PA 626 GM19211-PA 416..603 287..473 233 28.7 Plus
Dsec\GM21309-PA 855 GM21309-PA 224..411 72..265 213 26.8 Plus
Dsec\GM19211-PA 626 GM19211-PA 18..231 64..281 193 26.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:27:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20550-PA 553 GD20550-PA 1..544 1..544 2801 98.7 Plus
Dsim\GD10355-PA 658 GD10355-PA 8..235 37..266 271 32.4 Plus
Dsim\GD23251-PA 1122 GD23251-PA 405..798 74..452 250 24.5 Plus
Dsim\GD13503-PA 816 GD13503-PA 558..752 285..478 215 29.9 Plus
Dsim\GD11031-PA 734 GD11031-PA 99..285 73..267 208 28.7 Plus
Dsim\GD13503-PA 816 GD13503-PA 71..263 73..275 183 29.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:27:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24056-PA 575 GJ24056-PA 1..566 1..575 2016 70.8 Plus
Dvir\GJ18014-PA 662 GJ18014-PA 52..238 73..266 243 33.5 Plus
Dvir\GJ21180-PA 1104 GJ21180-PA 374..767 74..452 236 24 Plus
Dvir\GJ16967-PA 632 GJ16967-PA 422..609 287..473 225 29.8 Plus
Dvir\GJ20065-PA 686 GJ20065-PA 48..235 73..267 209 27.7 Plus
Dvir\GJ16967-PA 632 GJ16967-PA 1..234 33..281 201 28.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:27:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13560-PA 595 GK13560-PA 1..595 1..612 2107 71.4 Plus
Dwil\GK14778-PA 662 GK14778-PA 8..236 29..266 268 31.1 Plus
Dwil\GK14647-PA 1134 GK14647-PA 385..779 74..452 230 24.9 Plus
Dwil\GK16821-PA 814 GK16821-PA 551..745 285..478 218 30.5 Plus
Dwil\GK16068-PA 621 GK16068-PA 5..225 44..273 214 27.6 Plus
Dwil\GK16821-PA 814 GK16821-PA 71..262 73..275 178 28.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:27:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24495-PA 550 GE24495-PA 1..541 1..544 2566 96.9 Plus
Dyak\GE19446-PA 657 GE19446-PA 8..235 37..266 285 33.2 Plus
Dyak\GE18254-PA 1133 GE18254-PA 412..805 74..452 251 24.3 Plus
Dyak\GE14741-PA 210 GE14741-PA 1..187 288..473 220 28.9 Plus
Dyak\GE12384-PA 855 GE12384-PA 224..411 72..265 214 26.8 Plus

MIP12509.hyp Sequence

Translation from 192 to 2030

> MIP12509.hyp
MAENEPLNDLQSQVNGRILPAANGHTASATNGLVHANGKDAMKPSAPVQN
GNGNANGTHIEAPCCRDIHGKEPPDGGARAWLVMVSAFLCNGIIFGFINT
YGVIHSLLTDRLTKLGDPEASSKAALIGALAIGTTFLFSTMAGCLTDKIG
LRLTTFAGGVLSAGGLLLSSFCTENIGALYFTYGIMFGLGAALAYTPTLA
ILGHYFKRYLGKVSGFVTAGSSVFTVILPPCLDKLLGSYGLEGTLRIMSL
VSAFIILCSFVYKPLHPPPEPPKKKPGRSRINLFLRSIINVEIWKRKRFV
IWALCVPLALFGYFVPYVHMMQFVKTTFPGEDVNLPVMCIGITSGIGRLI
FGVIADMPGVNRMYLQQLSLVSIGLVTLLLPLTNSYVILVSFTLVMGLFD
GCFISLLGPIAYEICGPSGATQAIGFLLGLSSIPLTVGPPVAGMIFDSTN
SYTLPLILAGLPPLLGSSLLFLIKCVKEEENGVSAPRAVVLANGDIEIAG
NGHYRSAGTKSSAPLMGATNGINGSAPASPTIQSNGHVDNGTGSYPDSPW
PSPTRISDSAACDHSSSSLHTNPGTLLPSCSHTALLSGRSGSSKSLPLGD
EPKRRRYNYSIY*

MIP12509.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
kar-PB 612 CG12286-PB 1..612 1..612 3186 100 Plus
kar-PA 553 CG12286-PA 1..543 1..543 2813 100 Plus
CG11665-PB 658 CG11665-PB 8..234 37..265 285 33.3 Plus
CG11665-PA 658 CG11665-PA 8..234 37..265 285 33.3 Plus
Mct1-PB 626 CG3456-PB 417..603 288..473 250 28.9 Plus