Clone MIP13239 Report

Search the DGRC for MIP13239

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:132
Well:39
Vector:pOT2
Associated Gene/TranscriptDhap-at-RA
Protein status:MIP13239.pep: gold
Sequenced Size:3530

Clone Sequence Records

MIP13239.complete Sequence

3530 bp assembled on 2009-10-01

GenBank Submission: BT099931.1

> MIP13239.complete
CGGAGGAACCCCAATGCGGCGCTCGCACCGTGCAGAGGCCGCCGCGCAGC
CACCCAGCCGTCAAATTGCCGAATATCGATTCGCAGCTGCTGCAGATGTT
TTTTGGTCAACAAAACAAAACAGCCGCCGCTTCGCCGCCGAGCAAGCAAA
TATACAAAAATACGAAAATACCAAAATACAAGAAAGTCGGTCAGGGAGAA
CCGAAATAAGTCGCGAATTGTGAATTAAATGCGCTAAAATTGCGGTAGCC
CAGTGCAGTGCGGAAATAGAGGCATTCCAACTTGCAGCAAAGAGCAGCTC
ATATTGAAAATATATATATTTTTTTTTTTTGGAGACCAGTTTGAAGCGCA
GCGCGATGGATAGAAATCCCGTGAGGCAGTCGACGTCATCCGGCACCGTA
GAAGGTGAATCCAGCGAACAGGAGGAGCAGAAGACGCCCAGTGCGGCCGA
ATATATGAGGAACTTCAAGAACATCATAGCGCCGGGCAACGAGGCCTCCA
TGACCAGGGAGTTCAATCCGCAGGTGGCATACGAATTCGAAAAGTATCTC
AATCCGCAAAAGCTCAAGCAGCACGTCCTTAGGAGCGAGAAGCTGCGATC
CATTCTGGAGCACTATGCCAAGGAGTCGGGCACGCCGCTCAAGCAGATGG
AGCGTCAGGCCCGGGCGATCATTGATGAAATCGGCCTCGATCGGAATATG
GCCATCATCCGGTGGTGCGGCATTGCCATTACGGCGATCGGCAAGCGGAT
CTGCGATGGATTCTATGTCAATTCGGCTAGCATGGCCAATGTGCGCAAGG
ATATGGGCAAGTGCCCGGTGCTCTATCTGCCAAGTCATCGCAGCTACATG
GACTTCATCCTGATGTCCTACATCTGCTATTACTACGACATCGAGATACC
AGGAATAGCAGCCGGCATGGATTTCCACTCCATGTTCGGAATGGGCACCA
TGTTGAGGAAAACAGGAGCGTTCTTCATGCGCCGCAGCTTCTCCAACGAT
GAGCTATACTGGGATATTTTCCGGGAGTATATGTACGCGCTGGTGGCAAA
CTACCACATCGGCGTGGAGTTCTTCATTGAGGGCACGCGCTCCAGGAATT
TCAAAGCTCTGGTTCCCAAAATTGGACTACTCTCGATGGCTCTGTTGCCA
TATTTCACGGGCGAAGTGCCGGATGTGATGATTGTGCCAGTGAGTGTGGC
CTACGAACGCGTCCTGGAGGAGCAACTGTTCGTCTATGAGCTGCTGGGTG
TGCCCAAGCCCAAGGAGTCGACAAAGGGCTTTTTCAAGGCCCTAAAAATC
ATCGACGAGCGATTTGGCAAGATGTTCCTCGACTTCGGAGAGCCCATCTC
GGTCAAGGAGTTTTTCGGACACGACAGCGCGCAGCGAATGCAGCGAGCAG
GCGTGGGTGGTCACTTGCAGAAGCTGAACCGCCAGGAGGTGGAACTAGTC
AAACAGCTGGCCAATGAGATTATCTACCAGCAGCAGCGTCGCATTGTGAT
CTCCACGTTCAATCTGCTTAGCCTCTACTACGCCAGTCAATTGTATGCCC
AAAGGAGTGTCACTCTGGACGAGCTAGCACGAGGTGTTCTGCATCTGAAG
CGAATCTTCGAGCAGCTGGGCGCCCATGTTAGCACGACTCCGAGCAGCAT
TAAGGCGGATGTGATTGATGCTGTGGAGATACACTCGAATATTTTACATT
TCGCGACTGGCCGCCTGCAGTTTACGCCCATGGCAGCCAAGCAACTGGCG
GAGCAGATCGATGTTAAGCGCCTGAAAGCCCATGCCCTGTGTCCACAGAC
CATGGCGGTGGCTGTGCCCATGCTGGCACTGCAGCTCTACATTAATCCCT
GCATGTTCTGGCTGGCCAGACCCGCCTACCTGCTGCTGGCAGCGCTCAAG
GAGCAAAAGAATCAACAGAAGCAATCGACGGACATCTCGTACGATGCCAG
TTTGTGTGCCCTGCATGCGCACGTGACCACCATGGACGCGCTATTCCAGC
ACGAGTTCATCATTGAATCGAATCGCGAGGCGGCCGAGTTTGAGACGCAT
CTGCAGCTGCTGCTGGACGAACGAGTTGTGGAGGTAGAGACCAGTGGCCG
GATCAATGTGCAGGACAATGAATGCTCGCATGTCATTCTGGCCGCCCTGG
CGCCATTCCTCTGCCTCTACTACCAACTGGTGGTCACGTTAAGAAAGATC
CCTTTGGAGCTGGAGTTCAGTAACAAGGAGCTGCTCGTGCGCGTCCAGCA
GCATGTGGAGCAGCTCCTACAGCAACCCGGAGCCTCCGCCTCTCATGTGC
ACCCATATTGCCTGGCCCTGGACAATCTGAACATTGCCATCTATGCGCTA
ATCCAGAGGGGCTACCTAGTGAAGAGCAGGGACTCTGGTCAGATGAAGAT
CGCGTCCACTCCGGGAAAGTGCCTGCGAGAACTGGAAACGCAGCTTCTCG
AGTACTGTCAACTAATGCCATTTGCTCAATACTCGACGGCGGCCAACCAG
CAGGCCCAGTTCCACATAGCCAAGTTATAACTGGCAAACGGAAATGGGCC
GGCGAGGGAGGCGACAAGGGAGAGGGACACCGATTCGAGTACCGATACCC
AGTCGGGTCCCAATCAGTGTAGTACAATTACCATTTCATTGCCCATGCAG
TTCATCCAGTTTGTTGTCGGCCTGCTCAAGAATTGTCGCATCATCTGCAT
ACTTTTCATCATCGTGGTGTTGTCGCCGCTGTGGCAGCTGCTCCACTGGA
TCATCGTATCCACCCACTCATTCACGTAGGTTAACGGGGTGTCTGGTTAG
GATGGGTCGATACTAATAGTATCCTATTTATATTGGCATAATTAACATTC
CCTATTTTCCACCTGCCATTTAAGAGTTTTTGATAATGTACATAGCGACA
CCCATTTGTTAGGAAGACAAAAGAGCTATGCTAGAATAAGATTGAACTAC
AATTTTGTGACTAGCGAAATCGATCCATCCTTGAGTGTTAGTGTATCCGA
GTGCATAGAGAATCTTATAGTCTAACAACTGATATTTTATGTCCAGTTCG
TTATGAAGCAAATGAAATTCACGAAACCGCCAAAAACATACACTTGCAAA
AAAGTGGATTTTTCATTCAAAAATGTTGTATAGACAAGCCGGTTAGTGTT
AGATCCCATCGAAATATATATCACATATATTTTTAGCCGAGGAATTCATA
GAAATGTTGCCAACAAAATGTAACATTGAAAGCACATTCACTTTTTTTAA
CGAAAATAGTTTAGCACAATTTTTAAGTCAATTTTCACACGCATAAATGG
GTTTTTAATTTGTACACTAGAGTGTTGAACGCATTTTTGTTTAATTTTAA
GTTACTTTAGGTTTAAGCTGGTGTTAAGTTTGTTTCAGTTTCTGTATTTT
AAGTTGTTTATGCTCATCAACCCTGCATTATTTTTAAATATTCCATTGTG
CCAATAGAGAAGTCAGCACCACACAAAGAAAAATAAATAAAAAAAACTTG
CCCTAGTTATATAAAAAAAAAAAAAAAAAA

MIP13239.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:51:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dhap-at.a 3245 Dhap-at.a 66..3244 337..3515 15880 99.9 Plus
Dhap-at.b 3441 Dhap-at.b 262..3440 337..3515 15880 99.9 Plus
Dhap-at-RA 3278 Dhap-at-RA 103..3277 341..3515 15860 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:41:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 21308750..21310066 3512..2196 6555 99.8 Minus
chr3R 27901430 chr3R 21310123..21311400 2197..920 6345 99.8 Minus
chr3R 27901430 chr3R 21311652..21312231 920..341 2900 100 Minus
chr3R 27901430 chr3R 21313725..21314064 340..1 1700 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:41:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dhap-at-RC 2424 CG4625-PC 1..2424 356..2779 12120 100 Plus
Dhap-at-RB 2175 CG4625-PB 1..2175 356..2530 10875 100 Plus
Dhap-at-RA 2175 CG4625-PA 1..2175 356..2530 10875 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:14:16 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:41:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dhap-at-RC 3516 CG4625-RC 1..3512 1..3512 17545 100 Plus
Dhap-at-RA 3516 CG4625-RA 1..3512 1..3512 17545 100 Plus
Dhap-at-RB 3441 CG4625-RB 262..3437 337..3512 15865 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:41:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dhap-at-PC 807 CG4625-PC 1..807 356..2776 3825 99.9 Plus
Dhap-at-PB 724 CG4625-PB 1..724 356..2527 3461 100 Plus
Dhap-at-PA 724 CG4625-PA 1..724 356..2527 3461 100 Plus
mino-PB 757 CG5508-PB 101..347 638..1360 295 32 Plus
mino-PC 786 CG5508-PC 130..376 638..1360 295 32 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:41:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 25485613..25486938 3521..2196 6600 99.8 Minus
3R 32079331 3R 25486995..25488272 2197..920 6390 100 Minus
3R 32079331 3R 25488524..25489103 920..341 2900 100 Minus
3R 32079331 3R 25490597..25490936 340..1 1700 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:54
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 25226444..25227769 3521..2196 6600 99.8 Minus
3R 31820162 3R 25227826..25229103 2197..920 6390 100 Minus
3R 31820162 3R 25229355..25229934 920..341 2900 100 Minus
3R 31820162 3R 25231428..25231767 340..1 1700 100 Minus
Blast to na_te.dros performed 2014-11-27 09:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
Damb\P-element_T 3329 Damb\P-element_T P_T 3329bp Derived from AF012414. 1881..2037 3280..3430 122 57.9 Plus
gypsy12 10218 gypsy12 GYPSY12 10218bp 1688..1715 335..308 122 92.9 Minus
gypsy12 10218 gypsy12 GYPSY12 10218bp 9570..9597 335..308 122 92.9 Minus
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 6897..6922 301..326 121 96.2 Plus

MIP13239.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 11:26:24 Download gff for MIP13239.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 21313762..21314064 1..303 100   Minus
chr3R 21312442..21312457 304..319 93 <- Minus
chr3R 21311652..21312255 320..920 98 -> Minus
chr3R 21310123..21311399 921..2197 99 <- Minus
chr3R 21308750..21310064 2198..3512 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:29 Download gff for MIP13239.complete
Subject Subject Range Query Range Percent Splice Strand
Dhap-at-RA 1..2175 356..2530 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:36:37 Download gff for MIP13239.complete
Subject Subject Range Query Range Percent Splice Strand
Dhap-at-RA 1..2175 356..2530 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:31:39 Download gff for MIP13239.complete
Subject Subject Range Query Range Percent Splice Strand
Dhap-at-RC 1..2424 356..2779 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:26:24 Download gff for MIP13239.complete
Subject Subject Range Query Range Percent Splice Strand
Dhap-at-RC 1..2424 356..2779 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-01 10:42:17 Download gff for MIP13239.complete
Subject Subject Range Query Range Percent Splice Strand
Dhap-at-RA 1..3157 356..3512 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:36:37 Download gff for MIP13239.complete
Subject Subject Range Query Range Percent Splice Strand
Dhap-at-RA 1..3157 356..3512 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:31:39 Download gff for MIP13239.complete
Subject Subject Range Query Range Percent Splice Strand
Dhap-at-RA 1..3512 1..3512 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:26:24 Download gff for MIP13239.complete
Subject Subject Range Query Range Percent Splice Strand
Dhap-at-RA 1..3512 1..3512 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 11:26:24 Download gff for MIP13239.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25490597..25490936 1..340 100   Minus
3R 25488524..25489103 341..920 100 <- Minus
3R 25486995..25488271 921..2197 100 <- Minus
3R 25485622..25486936 2198..3512 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:31:39 Download gff for MIP13239.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 21316319..21316658 1..340 100   Minus
arm_3R 21314246..21314825 341..920 100 <- Minus
arm_3R 21312717..21313993 921..2197 100 <- Minus
arm_3R 21311344..21312658 2198..3512 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:19:52 Download gff for MIP13239.complete
Subject Subject Range Query Range Percent Splice Strand
3R 25231428..25231767 1..340 100   Minus
3R 25229355..25229934 341..920 100 <- Minus
3R 25227826..25229102 921..2197 100 <- Minus
3R 25226453..25227767 2198..3512 99 <- Minus

MIP13239.pep Sequence

Translation from 355 to 2529

> MIP13239.pep
MDRNPVRQSTSSGTVEGESSEQEEQKTPSAAEYMRNFKNIIAPGNEASMT
REFNPQVAYEFEKYLNPQKLKQHVLRSEKLRSILEHYAKESGTPLKQMER
QARAIIDEIGLDRNMAIIRWCGIAITAIGKRICDGFYVNSASMANVRKDM
GKCPVLYLPSHRSYMDFILMSYICYYYDIEIPGIAAGMDFHSMFGMGTML
RKTGAFFMRRSFSNDELYWDIFREYMYALVANYHIGVEFFIEGTRSRNFK
ALVPKIGLLSMALLPYFTGEVPDVMIVPVSVAYERVLEEQLFVYELLGVP
KPKESTKGFFKALKIIDERFGKMFLDFGEPISVKEFFGHDSAQRMQRAGV
GGHLQKLNRQEVELVKQLANEIIYQQQRRIVISTFNLLSLYYASQLYAQR
SVTLDELARGVLHLKRIFEQLGAHVSTTPSSIKADVIDAVEIHSNILHFA
TGRLQFTPMAAKQLAEQIDVKRLKAHALCPQTMAVAVPMLALQLYINPCM
FWLARPAYLLLAALKEQKNQQKQSTDISYDASLCALHAHVTTMDALFQHE
FIIESNREAAEFETHLQLLLDERVVEVETSGRINVQDNECSHVILAALAP
FLCLYYQLVVTLRKIPLELEFSNKELLVRVQQHVEQLLQQPGASASHVHP
YCLALDNLNIAIYALIQRGYLVKSRDSGQMKIASTPGKCLRELETQLLEY
CQLMPFAQYSTAANQQAQFHIAKL*

MIP13239.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 06:17:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17273-PA 722 GF17273-PA 1..722 1..724 3370 87 Plus
Dana\GF18869-PA 853 GF18869-PA 193..442 93..336 326 31.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 06:17:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12243-PA 715 GG12243-PA 1..715 1..724 3747 96.3 Plus
Dere\GG11581-PA 852 GG11581-PA 196..443 95..336 320 31.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 06:17:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18612-PA 716 GH18612-PA 3..716 12..724 2975 81.4 Plus
Dgri\GH18409-PA 860 GH18409-PA 192..495 95..413 317 28.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 06:17:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dhap-at-PC 807 CG4625-PC 1..724 1..724 3708 100 Plus
Dhap-at-PB 724 CG4625-PB 1..724 1..724 3708 100 Plus
Dhap-at-PA 724 CG4625-PA 1..724 1..724 3708 100 Plus
mino-PB 757 CG5508-PB 101..404 95..412 297 27.6 Plus
mino-PC 786 CG5508-PC 130..433 95..412 297 27.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 06:17:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10360-PA 725 GI10360-PA 34..725 33..724 3159 84.6 Plus
Dmoj\GI24312-PA 860 GI24312-PA 190..437 95..336 326 33.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 06:17:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21684-PA 630 GL21684-PA 1..630 98..724 3027 87.1 Plus
Dper\GL23642-PA 872 GL23642-PA 212..459 95..336 329 31.5 Plus
Dper\GL21683-PA 93 GL21683-PA 46..91 30..75 217 87 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 06:17:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18312-PA 743 GA18312-PA 46..743 30..724 3338 86.8 Plus
Dpse\GA18937-PB 850 GA18937-PB 190..437 95..336 332 31.5 Plus
Dpse\GA18937-PD 758 GA18937-PD 98..345 95..336 331 31.5 Plus
Dpse\GA18937-PC 787 GA18937-PC 127..374 95..336 330 31.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 06:17:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10240-PA 723 GM10240-PA 1..723 1..724 3758 97.2 Plus
Dsec\GM16363-PA 849 GM16363-PA 194..441 95..336 314 31.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 06:17:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18193-PA 723 GD18193-PA 1..723 1..724 3777 97.8 Plus
Dsim\GD21357-PA 850 GD21357-PA 194..441 95..336 321 31.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 06:17:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10212-PA 719 GJ10212-PA 24..719 29..724 3213 86.4 Plus
Dvir\GJ10396-PA 859 GJ10396-PA 191..438 95..336 325 32.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 06:17:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13976-PA 716 GK13976-PA 16..716 25..724 3211 84.9 Plus
Dwil\GK12826-PA 837 GK12826-PA 182..429 95..336 328 31.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 06:17:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10692-PA 726 GE10692-PA 1..726 1..724 3735 95.7 Plus
Dyak\GE23770-PA 847 GE23770-PA 194..441 95..336 318 31.9 Plus

MIP13239.hyp Sequence

Translation from 355 to 2529

> MIP13239.hyp
MDRNPVRQSTSSGTVEGESSEQEEQKTPSAAEYMRNFKNIIAPGNEASMT
REFNPQVAYEFEKYLNPQKLKQHVLRSEKLRSILEHYAKESGTPLKQMER
QARAIIDEIGLDRNMAIIRWCGIAITAIGKRICDGFYVNSASMANVRKDM
GKCPVLYLPSHRSYMDFILMSYICYYYDIEIPGIAAGMDFHSMFGMGTML
RKTGAFFMRRSFSNDELYWDIFREYMYALVANYHIGVEFFIEGTRSRNFK
ALVPKIGLLSMALLPYFTGEVPDVMIVPVSVAYERVLEEQLFVYELLGVP
KPKESTKGFFKALKIIDERFGKMFLDFGEPISVKEFFGHDSAQRMQRAGV
GGHLQKLNRQEVELVKQLANEIIYQQQRRIVISTFNLLSLYYASQLYAQR
SVTLDELARGVLHLKRIFEQLGAHVSTTPSSIKADVIDAVEIHSNILHFA
TGRLQFTPMAAKQLAEQIDVKRLKAHALCPQTMAVAVPMLALQLYINPCM
FWLARPAYLLLAALKEQKNQQKQSTDISYDASLCALHAHVTTMDALFQHE
FIIESNREAAEFETHLQLLLDERVVEVETSGRINVQDNECSHVILAALAP
FLCLYYQLVVTLRKIPLELEFSNKELLVRVQQHVEQLLQQPGASASHVHP
YCLALDNLNIAIYALIQRGYLVKSRDSGQMKIASTPGKCLRELETQLLEY
CQLMPFAQYSTAANQQAQFHIAKL*

MIP13239.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dhap-at-PC 807 CG4625-PC 1..724 1..724 3708 100 Plus
Dhap-at-PB 724 CG4625-PB 1..724 1..724 3708 100 Plus
Dhap-at-PA 724 CG4625-PA 1..724 1..724 3708 100 Plus
mino-PB 757 CG5508-PB 101..404 95..412 297 27.6 Plus
mino-PC 786 CG5508-PC 130..433 95..412 297 27.6 Plus