Clone MIP13269 Report

Search the DGRC for MIP13269

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:132
Well:69
Vector:pOT2
Associated Gene/TranscriptCG30377-RA
Protein status:MIP13269.pep: gold
Sequenced Size:3380

Clone Sequence Records

MIP13269.complete Sequence

3380 bp assembled on 2009-10-13

GenBank Submission: BT100051.1

> MIP13269.complete
TTGTCGCCTGTCCATTGTCGGTTGTTGCTTGCTGCGCGTAGCGTGTTGCG
TGTTGCGCCTTGTCGGCGGTTGTTGCAGGTTGCCCCGTTAAAGTCAAACA
TTTATGCAACTCGGCCGAAAGCAGCAGCAGCAGCAGGAAAATCGACATCT
GGCCAAGGGACGTACTACATTCGCAATTGAAGTCTGTGTGAGACAACCAT
GCCCATTTGCAAAAGTTCACCGGGTACGGCGAGCAACAAAACAGCCACGG
ATATATCCGCCGACCACGTGACGGAAGCGGCCCAGGTGAAGCGGACGCGG
GAGCAGGCCTACTTCAACTCCTACGACTTCGATGCAATCGAGGTGCTGCC
CTACGAGGAGGAGGACGACGAGGCGGGAGGCACCAGTCACAGCAGGAGCA
GGAGCAGGAGCCAGAGCCGTAGCCAAAGTCGTTGCGGAAGCAGCAGCAGC
CGGAGCAGCAGCACCAGGAGCTACTCCGCAGCCAAGGAGCCCGTTGCCGG
CCACAAGTTTGCCTATCTGCAACGCCTGGGCGCCTTTTTTGCTCGCAACG
GAGGTGGAGCAGGCGAATCGGGATCGGGAGAAGCTGCTGGTATAGCTGCT
CCAAGTGGAGGAGGTGCATCCAACGCGGCGCCCAAGGGAAGCAGCGAAAA
TTTTCTACTGCCACGAGCCATGCTTAAATATCAAAGCACGGCGACAGCAT
CAGCCTCGCCATCGTCCACATCCACGGCAGCGGTTGCAATGCCACTGAAG
AATGGACTGGCCAATGGAATGGGGAATGCAATTGGTCACGACCAACAGCT
GGAGGCGACCGGCAGCGCGGGGGAGCGCAGCAAGAAGTGCTCGATTGCGT
CCAATGTCAGCAGCACGCATTCCACGGATTCCGGACTGCCAGTCGCAGCA
GCAGCAGTATCAGCATCAGCATCAGCTTCAGCGGCAGCATCTGCGACTGC
AGCAACATCTGCTGCAGCAGCGGCAGCAGCAGCACAGGCGGCGCGTGGCG
GAGGAGGTGATGGTGGCGGCTCACACTATTCGACGGACAAAAGCGGCTCG
TCCGGTTATTACAGCTCCAATGTGTGCTCCACTTACTCGCTGGACGAGCA
CATCTATTGCGAACCAGTCATCGATGTCCAGGAGAAGATCAAGAGTGTGG
CCGCCAGACAGCGGCAAAGACCACCGCTCCAGCTACCAACGAAAGTGGGC
GCTCCGCAGGAGGCGCCATCGATAGACCCACCGGAAGGCTCATCGGAAAA
GTTGTCCGCAGTGAAGAGTCAGCGCTCGGACATGCAAGATGCAGCCGGAG
CTGCCGCATCGAATAGCCATCAAACGCAGTCGAAGGCCGAGGCGGCCGAG
GGGCTGCATCACTACAGCAAAAAGCTGCGAGTTCTGGAGACGAGCATCGA
GAATCTGGACCGCCACCTGAAGACTTTTCCCAGTCTGTATGCCCAAGAGC
ATATTGTGAGCTTCATGCAAGTGGCCGGCGCAAGAAACGAAGGCCCACCC
CAGGCTCTGGATATTGGAGAGAAGCTAAGGGTCTACAACCAGTTGCCCAC
CATCATGGAGCAGCAGCAGCAGCAGCAACAGGAGCAGATGGTGGATGATT
CATTGCTGGATATTGACCTAGATGCCTTTCTTTTGGCGCCCAACGCGGGG
CATCGTGGCATCGACAATCCCAGCTTTCTGAACGACGAGCAGCTGGCGGA
GAACAACTACAAGTGCGCCAAGTACATCAACTCCTGTCCCGAAGATGCCT
ACCGCCTGGAGAGCGAAAGGGGCGGAGCGGGAGGACCTGGTGTGGGCGTG
GCAGAGGAGACATATGTCAAGCGGTATGAGGATCAGTTGCACTTCCAGAA
CACGCGGGAGCTGTTGGAGGACGTCCGTGATAAGATCCGCCTCCTATCGC
GTGCCACACCCCCGACTTCGGGCACGCCCACACCCGCCAGCACCCCGCCC
TCCGATGTGCCCAAGGAACTGGAAGGGATGATCCACACGCTGAAGCACGA
ACTAGAGTCGTACCTGCAGCGCATGAACCAGCACAGTGAGCTGGAACTCC
GGCAGTTGTGCAGCGGCTTGGGACGCCAGCAGCACGTGGTCCGCATGCAA
AACGCCCTGGAACGCAGACGCAGTTGCGCCGATCTTCAACTGAATGCCTA
CGAGGCAGTACGGGATGGAGTACTCATCTCCGCCAATGGCCGACCTCTCA
GCGTTCGCGAGCAGATCATGACCATTCGTTGTGCCAGCGATCCCAACTTC
AAGATGAAGCGCAAGTCCATAGCGGAGATCTTTCCCGCCGCCGAATGCTA
TGTGGAATCGGAGGTCACCACCACCAGTCTCTCGCGCAGTGCCACGCCCT
CGCCCGCCTCAACGCCGCAGTTGGAGCTCGAGGCATTGCATCCAGGCCTA
GCTACGACCACAATAGTTACGCAAATGCAGCGCAACCTCACCTTCCACAA
GCCCATTCTCGCGGTGTCCAACAGCAATCCTGGAGGTGGAAATGTGACGG
TGGACGGAGCTGGCGGCAATAAGGCCGAGCGGGATCGGGAGCGGGAAAGC
CTCGCCGAGTGGCACCGCAAGAAGCCCAGCATCTGGGAGATGTACTACGG
CACCAATCGGCTCCATCAGTCGCTCCTCGGGAAGCAGCGAGGTGGAGGCG
AACTGGTCATCAGCAGTGCCCAGCCCACTCTGTCCTATCCATCCTCGCGA
CCCGAATCGGACTTCACGCTCGACCTGCCGCGGGCGGAACAGCTGCGTCT
GAAAATGGAGAAGGAGAAGAAGTTCCGCCAAAGATGTCGCTTCATCACCA
CGTTCCTCAGCCTGGTCTTTTTCCTGCTGACTGTGATGGTGGTCAGCCTG
GTTCTGACGCGCGGCAAACGGATGTTTGGCAGCATGATTTGATTTCGGGA
ATTCCCATCGGGGATGCCGATCGCCGACCCACGCCGTTGGCTATGTAGCC
ACACCAGTTAGCTCCTAGATCCGACTCTGGTAGGTCGGGAGAATGGAAAA
TGGCTCGGCGGAATATTACAAACTACAGTGCCAACTACAAATGTAAAACG
TTAGCGAAGCTCAAGTTTAGTGTTAGCGGTAGTCGTAAGCTCCTGTGGTA
TTTCTTGGCAGGGCAGGGCCGCCACAGCCACAGCCGCAGTCGCAGTATTG
TTAATAAATTATTTATGTGATCCTAGTTAATAAGTACAAGTTAGTGCATT
TGTTTCCGTGCGTACGCGTATACTGCCTGTATCCAGCCTATGTATATCCT
TTGTCACAGCTATCCATAAGCCCATTAACCTGTATTAAGTCTACGTTTGT
AACCAATTATAGCTAGATTCGTCCTGTGAAAGTGTGAAGAATAAAGAGAG
AAGCGAGTACATGTAAAAAAAAAAAAAAAA

MIP13269.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:54:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG30377.d 4140 CG30377.d 883..4140 85..3342 16290 100 Plus
CG30377.b 3482 CG30377.b 225..3482 85..3342 16290 100 Plus
CG30377.c 3536 CG30377.c 386..3536 192..3342 15755 100 Plus
CG30377.d 4140 CG30377.d 135..218 1..84 420 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 02:37:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 3792813..3794816 685..2688 10020 100 Plus
chr2R 21145070 chr2R 3801731..3802406 2689..3364 3335 99.6 Plus
chr2R 21145070 chr2R 3788309..3788804 191..686 2480 100 Plus
chr2R 21145070 chr2R 3778164..3778271 85..192 540 100 Plus
chr2R 21145070 chr2R 3777416..3777499 1..84 420 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 02:37:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG30377-RB 2694 CG30377-PB 1..2694 199..2892 13470 100 Plus
CG30377-RA 2694 CG30377-PA 1..2694 199..2892 13470 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:14:22 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 02:37:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG30377-RA 3414 CG30377-RA 51..3414 1..3364 16820 100 Plus
CG30377-RB 4078 CG30377-RB 799..4078 85..3364 16400 100 Plus
CG30377-RB 4078 CG30377-RB 51..134 1..84 420 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 02:37:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG30377-PB 897 CG30377-PB 1..897 199..2889 3195 100 Plus
CG30377-PA 897 CG30377-PA 1..897 199..2889 3195 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 02:37:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 7905441..7907444 685..2688 10020 100 Plus
2R 25286936 2R 7914357..7915034 2689..3366 3390 100 Plus
2R 25286936 2R 7900945..7901440 191..686 2480 100 Plus
2R 25286936 2R 7890823..7890930 85..192 540 100 Plus
2R 25286936 2R 7890075..7890158 1..84 420 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:51:02
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 7906640..7908643 685..2688 10020 100 Plus
2R 25260384 2R 7915556..7916233 2689..3366 3390 100 Plus
2R 25260384 2R 7902144..7902639 191..686 2480 100 Plus
2R 25260384 2R 7892022..7892129 85..192 540 100 Plus
2R 25260384 2R 7891274..7891357 1..84 420 100 Plus
Blast to na_te.dros performed on 2014-11-27 02:37:25 has no hits.

MIP13269.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 04:21:05 Download gff for MIP13269.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 3801731..3802406 2689..3364 99   Plus
chr2R 3793113..3794816 985..2688 98 -> Plus
chr2R 3792815..3793013 687..885 100 == Plus
chr2R 3788590..3788804 472..686 100 -> Plus
chr2R 3788311..3788497 193..379 100 == Plus
chr2R 3778164..3778271 85..192 100 -> Plus
chr2R 3777416..3777499 1..84 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:15:40 Download gff for MIP13269.complete
Subject Subject Range Query Range Percent Splice Strand
CG30377-RA 1..2694 199..2892 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:44:05 Download gff for MIP13269.complete
Subject Subject Range Query Range Percent Splice Strand
CG30377-RA 1..2694 199..2892 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:38:52 Download gff for MIP13269.complete
Subject Subject Range Query Range Percent Splice Strand
CG30377-RA 1..2694 199..2892 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:21:05 Download gff for MIP13269.complete
Subject Subject Range Query Range Percent Splice Strand
CG30377-RA 1..2694 199..2892 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:15:40 Download gff for MIP13269.complete
Subject Subject Range Query Range Percent Splice Strand
CG30377-RA 1..3144 199..3342 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:44:05 Download gff for MIP13269.complete
Subject Subject Range Query Range Percent Splice Strand
CG30377-RA 1..3364 1..3364 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:38:52 Download gff for MIP13269.complete
Subject Subject Range Query Range Percent Splice Strand
CG30377-RA 51..3414 1..3364 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:21:05 Download gff for MIP13269.complete
Subject Subject Range Query Range Percent Splice Strand
CG30377-RA 51..3414 1..3364 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 04:21:05 Download gff for MIP13269.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7914357..7915032 2689..3364 100   Plus
2R 7905443..7907444 687..2688 100 -> Plus
2R 7900947..7901440 193..686 100 -> Plus
2R 7890823..7890930 85..192 100 -> Plus
2R 7890075..7890158 1..84 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:38:52 Download gff for MIP13269.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 3801862..3802537 2689..3364 100   Plus
arm_2R 3792948..3794949 687..2688 100 -> Plus
arm_2R 3788452..3788945 193..686 100 -> Plus
arm_2R 3778328..3778435 85..192 100 -> Plus
arm_2R 3777580..3777663 1..84 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:24:49 Download gff for MIP13269.complete
Subject Subject Range Query Range Percent Splice Strand
2R 7915556..7916231 2689..3364 100   Plus
2R 7906642..7908643 687..2688 100 -> Plus
2R 7902146..7902639 193..686 100 -> Plus
2R 7892022..7892129 85..192 100 -> Plus
2R 7891274..7891357 1..84 100 -> Plus

MIP13269.pep Sequence

Translation from 198 to 2891

> MIP13269.pep
MPICKSSPGTASNKTATDISADHVTEAAQVKRTREQAYFNSYDFDAIEVL
PYEEEDDEAGGTSHSRSRSRSQSRSQSRCGSSSSRSSSTRSYSAAKEPVA
GHKFAYLQRLGAFFARNGGGAGESGSGEAAGIAAPSGGGASNAAPKGSSE
NFLLPRAMLKYQSTATASASPSSTSTAAVAMPLKNGLANGMGNAIGHDQQ
LEATGSAGERSKKCSIASNVSSTHSTDSGLPVAAAAVSASASASAAASAT
AATSAAAAAAAAQAARGGGGDGGGSHYSTDKSGSSGYYSSNVCSTYSLDE
HIYCEPVIDVQEKIKSVAARQRQRPPLQLPTKVGAPQEAPSIDPPEGSSE
KLSAVKSQRSDMQDAAGAAASNSHQTQSKAEAAEGLHHYSKKLRVLETSI
ENLDRHLKTFPSLYAQEHIVSFMQVAGARNEGPPQALDIGEKLRVYNQLP
TIMEQQQQQQQEQMVDDSLLDIDLDAFLLAPNAGHRGIDNPSFLNDEQLA
ENNYKCAKYINSCPEDAYRLESERGGAGGPGVGVAEETYVKRYEDQLHFQ
NTRELLEDVRDKIRLLSRATPPTSGTPTPASTPPSDVPKELEGMIHTLKH
ELESYLQRMNQHSELELRQLCSGLGRQQHVVRMQNALERRRSCADLQLNA
YEAVRDGVLISANGRPLSVREQIMTIRCASDPNFKMKRKSIAEIFPAAEC
YVESEVTTTSLSRSATPSPASTPQLELEALHPGLATTTIVTQMQRNLTFH
KPILAVSNSNPGGGNVTVDGAGGNKAERDRERESLAEWHRKKPSIWEMYY
GTNRLHQSLLGKQRGGGELVISSAQPTLSYPSSRPESDFTLDLPRAEQLR
LKMEKEKKFRQRCRFITTFLSLVFFLLTVMVVSLVLTRGKRMFGSMI*

MIP13269.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13640-PA 881 GF13640-PA 1..881 1..897 2846 74 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23310-PA 908 GG23310-PA 1..908 1..897 3684 90.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21297-PA 940 GH21297-PA 1..940 1..897 2320 58.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:49:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG30377-PB 897 CG30377-PB 1..897 1..897 4559 100 Plus
CG30377-PA 897 CG30377-PA 1..897 1..897 4559 100 Plus
sbb-PE 929 CG5580-PE 103..406 11..290 168 26 Plus
sbb-PC 929 CG5580-PC 103..406 11..290 168 26 Plus
sbb-PF 939 CG5580-PF 113..416 11..290 168 26 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:50:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19785-PA 895 GI19785-PA 1..895 1..897 1978 51.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11693-PA 586 GL11693-PA 1..480 1..459 989 57.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15799-PA 923 GA15799-PA 1..923 1..897 2725 65.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20988-PA 898 GM20988-PA 1..898 1..897 3873 94.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10515-PA 137 GD10515-PA 71..137 831..897 356 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17741-PA 850 GJ17741-PA 470..850 487..897 1528 73 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21970-PA 821 GK21970-PA 1..813 1..830 2187 60 Plus
Dwil\GK19413-PA 67 GK19413-PA 1..67 831..897 359 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19155-PA 892 GE19155-PA 1..892 1..897 3714 88.8 Plus

MIP13269.hyp Sequence

Translation from 198 to 2891

> MIP13269.hyp
MPICKSSPGTASNKTATDISADHVTEAAQVKRTREQAYFNSYDFDAIEVL
PYEEEDDEAGGTSHSRSRSRSQSRSQSRCGSSSSRSSSTRSYSAAKEPVA
GHKFAYLQRLGAFFARNGGGAGESGSGEAAGIAAPSGGGASNAAPKGSSE
NFLLPRAMLKYQSTATASASPSSTSTAAVAMPLKNGLANGMGNAIGHDQQ
LEATGSAGERSKKCSIASNVSSTHSTDSGLPVAAAAVSASASASAAASAT
AATSAAAAAAAAQAARGGGGDGGGSHYSTDKSGSSGYYSSNVCSTYSLDE
HIYCEPVIDVQEKIKSVAARQRQRPPLQLPTKVGAPQEAPSIDPPEGSSE
KLSAVKSQRSDMQDAAGAAASNSHQTQSKAEAAEGLHHYSKKLRVLETSI
ENLDRHLKTFPSLYAQEHIVSFMQVAGARNEGPPQALDIGEKLRVYNQLP
TIMEQQQQQQQEQMVDDSLLDIDLDAFLLAPNAGHRGIDNPSFLNDEQLA
ENNYKCAKYINSCPEDAYRLESERGGAGGPGVGVAEETYVKRYEDQLHFQ
NTRELLEDVRDKIRLLSRATPPTSGTPTPASTPPSDVPKELEGMIHTLKH
ELESYLQRMNQHSELELRQLCSGLGRQQHVVRMQNALERRRSCADLQLNA
YEAVRDGVLISANGRPLSVREQIMTIRCASDPNFKMKRKSIAEIFPAAEC
YVESEVTTTSLSRSATPSPASTPQLELEALHPGLATTTIVTQMQRNLTFH
KPILAVSNSNPGGGNVTVDGAGGNKAERDRERESLAEWHRKKPSIWEMYY
GTNRLHQSLLGKQRGGGELVISSAQPTLSYPSSRPESDFTLDLPRAEQLR
LKMEKEKKFRQRCRFITTFLSLVFFLLTVMVVSLVLTRGKRMFGSMI*

MIP13269.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG30377-PB 897 CG30377-PB 1..897 1..897 4559 100 Plus
CG30377-PA 897 CG30377-PA 1..897 1..897 4559 100 Plus
sbb-PE 929 CG5580-PE 103..406 11..290 168 26 Plus
sbb-PC 929 CG5580-PC 103..406 11..290 168 26 Plus
sbb-PF 939 CG5580-PF 113..416 11..290 168 26 Plus