Clone MIP13630 Report

Search the DGRC for MIP13630

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:136
Well:30
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG1308-RE
Protein status:MIP13630.pep: wuzgold
Sequenced Size:1732

Clone Sequence Records

MIP13630.complete Sequence

1732 bp assembled on 2009-09-28

GenBank Submission: BT099886.1

> MIP13630.complete
GTGCCTCTAGCTGTGTGAAAATTTGGCCAAAAAGTTCTTGTAAATGTGCT
GAAATCTGAATCACGGCTTGCAACCTCTGTAGAGGCTATCACTCTGACTA
TATAGACGTTCGCTCCCAAGGAGGAGCTCGGAAAACAACGCCGAAATAGA
GCAAAACCTGGGCTGTGGACAAAACAACCTACATCGTCGGCAACATTTTT
TTTTGTAAACAAATAATTCGCCTTGGGGAAAAACTCGGCTAGCAATTAAC
AAATGCCGTTCAGTTGAGAAAATTGCTGGAAAAAACGCGACGATGGACAA
TAAGAAGGATATATACAATCTGTGGGTGCAGTACACGACAAAGAATGATG
AAACCCACTTCCGGCAATTTGTGGCCCGCTTCGTGGCCATTTGGAGGAGC
CAACTGCAGCTAGACTTTCAGGCGGAAAATTGCCCGATGTGGCACGAGGT
TCAGCCGGATAGTGGTCCCCACTTGGGCCGCCTCCCGGATGAACTCCTGC
CCGCCATCGGTAAATTCATCATTGTAGCCAGAGATGTTTGCGAAACGGAA
GGGAAACTGGAGGAGCAGGCCATTGAAGAAGTAGCCATACTCGTGGATTG
TCTGGTGATCGTGTGCCGGCACTTTGATAACATACTGTCCATCATCAAGT
ATGAATACAAGCCGAATTTGATCGCCATACTCTCCAGGGTGTTCAAACAA
CAAATGGAGCTGCCGCAGAGCGTGCCCGCAATAAGCCACCTGTTTAGCAG
TTTCTCGGCATTCCTGGAAGTCATGTATGATCCATATCTGACGTGGCGCA
GCTTCGTGCGAGGCCAGTCAGCTGACTACAGTCGTCTTTCATATAAACCC
CACTCGGTTCATGTGGAAATTGTCCCCTTTATTTATGATTGCTTTCAGGA
GGAGAAGCTCATCCGATATGCGGAAATTGGCGAAAGCCTGCTAAACATCC
TGGGCGCTGTGATTTGCGGCTCACAGGTAGCGCCAGAAAGCGTCTCCAGT
CCCTTCCTGTGTAGTCCTTTCTCTCTTAAAAACCGTTTAATTATTAACCT
CACTTCCTGACAGCTTACCTTTCTGCTCACTGCTTTCGCTATTAATGTAC
GTTAGAGCTCTATCATTTTGTTTCCTTGTCCTATTTCGTTTCATTTCGTG
TATCGTTGTGTGGCTGGATCTCCTCCAGCTGCAGCTGAAAGTGCAGAAGT
CTCTAAACTCGACCTCGACCCTGACAAATAGAAATACTAACGCTCTAACC
ACTTCTTCACTTGCCCCCTGCTCGGGTGATGGGCTGCTAGACTGTGATAA
CTTGCGCAATGGTATGAAGGCCATTTGCCCCGCCACGGTGTCCATTACCA
TGAGTATCCTGCGACAATGGGAGAGTGCCAATAATCTGCGCCGCGTAGCC
CTGCAATGCTATGCGCTGATGGTCATTGTGCTGCAGAAATCTAGTCCGGA
AGAACGCCAAATAGACCTAGTTACGTTAGTTCAACTGTATTGTGATGCTC
TCCAAGAGCTCCTGGCCACAAAGCACTTCGATAGCGGGGATGCCAATTTC
GATATAACCAGCGATGCTGACCAGGATGTGGCTATCGACATGGCTGCACT
CTCCTCCACCGTAGCGGCTGTTAAATTCTTTGTCACAGGCGATGCAGGTG
TTAGTGAAGCCGTTTCCGATTCCAATCTATTGGAACTGCTTACCAATCTG
CCAAAGCTTATAAAACCCTGGCATATTTCCCA

MIP13630.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG1308.a 5323 CG1308.a 1..712 265..976 3560 100 Plus
CG1308.b 5317 CG1308.b 1..712 265..976 3560 100 Plus
CG1295.a 5482 CG1295.a 1..712 265..976 3560 100 Plus
CG1308.a 5323 CG1308.a 710..1266 1176..1732 2785 100 Plus
CG1308.b 5317 CG1308.b 710..1260 1182..1732 2755 100 Plus
CG1295.a 5482 CG1295.a 712..1140 1304..1732 2145 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 21:35:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 4194684..4195101 887..1304 2090 100 Plus
chr3L 24539361 chr3L 4193941..4194300 341..700 1800 100 Plus
chr3L 24539361 chr3L 4193379..4193721 1..343 1715 100 Plus
chr3L 24539361 chr3L 4195433..4195693 1455..1715 1305 100 Plus
chr3L 24539361 chr3L 4194364..4194550 701..887 935 100 Plus
chr3L 24539361 chr3L 4195226..4195376 1304..1454 755 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:35:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG43367-RD 8139 CG43367-PD 1..684 293..976 3420 100 Plus
CG43367-RC 8265 CG43367-PC 1..684 293..976 3420 100 Plus
CG43367-RF 7665 CG43367-PF 1..637 1095..1731 3185 100 Plus
CG43367-RC 8265 CG43367-PC 682..1237 1176..1731 2780 100 Plus
CG43367-RD 8139 CG43367-PD 684..1111 1304..1731 2140 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:14:45 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:35:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG43367-RE 10170 CG43367-RE 1..1731 1..1731 8655 100 Plus
CG43367-RF 9817 CG43367-RF 1..1378 354..1731 6890 100 Plus
CG43367-RD 9842 CG43367-RD 1..976 1..976 4880 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 21:35:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG43367-PC 2754 CG1308-PB 1..253 293..1057 1205 92.5 Plus
CG43367-PD 2712 CG43367-PD 1..241 293..997 1203 95.9 Plus
CG43367-PF 2554 CG43367-PF 1..212 1095..1730 795 100 Plus
CG43367-PE 2554 CG43367-PE 1..212 1095..1730 795 100 Plus
CG43367-PC 2754 CG1308-PB 257..412 1263..1730 727 100 Plus
CG43367-PD 2712 CG43367-PD 221..370 1281..1730 656 96 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 21:35:50
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 4195298..4195715 887..1304 2090 100 Plus
3L 28110227 3L 4194555..4194914 341..700 1800 100 Plus
3L 28110227 3L 4193993..4194335 1..343 1715 100 Plus
3L 28110227 3L 4196047..4196307 1455..1715 1305 100 Plus
3L 28110227 3L 4194978..4195164 701..887 935 100 Plus
3L 28110227 3L 4195840..4195990 1304..1454 755 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:13
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 4195298..4195715 887..1304 2090 100 Plus
3L 28103327 3L 4194555..4194914 341..700 1800 100 Plus
3L 28103327 3L 4193993..4194335 1..343 1715 100 Plus
3L 28103327 3L 4196047..4196307 1455..1715 1305 100 Plus
3L 28103327 3L 4194978..4195164 701..887 935 100 Plus
3L 28103327 3L 4195840..4195990 1304..1454 755 100 Plus
Blast to na_te.dros performed on 2014-11-26 21:35:51 has no hits.

MIP13630.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 22:39:26 Download gff for MIP13630.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 4195748..4195763 1716..1731 100   Plus
chr3L 4195433..4195693 1455..1715 100 -> Plus
chr3L 4195227..4195376 1305..1454 100 -> Plus
chr3L 4194685..4195101 888..1304 100 -> Plus
chr3L 4194364..4194550 701..887 100 -> Plus
chr3L 4193944..4194300 344..700 100 -> Plus
chr3L 4193379..4193721 1..343 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:56 Download gff for MIP13630.complete
Subject Subject Range Query Range Percent Splice Strand
CG1308-RA 1..666 293..958 100 == Plus
CG1308-RA 667..1093 1305..1731 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:35:08 Download gff for MIP13630.complete
Subject Subject Range Query Range Percent Splice Strand
CG1308-RE 1..768 293..1060 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:33:18 Download gff for MIP13630.complete
Subject Subject Range Query Range Percent Splice Strand
CG43367-RC 698..1238 1192..1732 100   Plus
CG43367-RC 1..697 293..990 99 == Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:39:26 Download gff for MIP13630.complete
Subject Subject Range Query Range Percent Splice Strand
CG43367-RC 698..1238 1192..1732 100   Plus
CG43367-RC 1..697 293..990 99 == Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 14:20:21 Download gff for MIP13630.complete
Subject Subject Range Query Range Percent Splice Strand
CG1308-RA 1..666 293..958 100 == Plus
CG1308-RA 667..1093 1305..1731 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:35:07 Download gff for MIP13630.complete
Subject Subject Range Query Range Percent Splice Strand
CG1308-RE 1..1731 1..1731 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:33:18 Download gff for MIP13630.complete
Subject Subject Range Query Range Percent Splice Strand
CG43367-RE 1..1731 1..1731 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:39:26 Download gff for MIP13630.complete
Subject Subject Range Query Range Percent Splice Strand
CG43367-RE 1..1731 1..1731 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 22:39:26 Download gff for MIP13630.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4196362..4196377 1716..1731 100   Plus
3L 4196047..4196307 1455..1715 100 -> Plus
3L 4195841..4195990 1305..1454 100 -> Plus
3L 4195299..4195715 888..1304 100 -> Plus
3L 4194978..4195164 701..887 100 -> Plus
3L 4194558..4194914 344..700 100 -> Plus
3L 4193993..4194335 1..343 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:33:18 Download gff for MIP13630.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 4196362..4196377 1716..1731 100   Plus
arm_3L 4196047..4196307 1455..1715 100 -> Plus
arm_3L 4195841..4195990 1305..1454 100 -> Plus
arm_3L 4195299..4195715 888..1304 100 -> Plus
arm_3L 4194978..4195164 701..887 100 -> Plus
arm_3L 4194558..4194914 344..700 100 -> Plus
arm_3L 4193993..4194335 1..343 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:48 Download gff for MIP13630.complete
Subject Subject Range Query Range Percent Splice Strand
3L 4196362..4196377 1716..1731 100   Plus
3L 4196047..4196307 1455..1715 100 -> Plus
3L 4195841..4195990 1305..1454 100 -> Plus
3L 4195299..4195715 888..1304 100 -> Plus
3L 4194978..4195164 701..887 100 -> Plus
3L 4194558..4194914 344..700 100 -> Plus
3L 4193993..4194335 1..343 100 -> Plus

MIP13630.pep Sequence

Translation from 292 to 1059

> MIP13630.pep
MDNKKDIYNLWVQYTTKNDETHFRQFVARFVAIWRSQLQLDFQAENCPMW
HEVQPDSGPHLGRLPDELLPAIGKFIIVARDVCETEGKLEEQAIEEVAIL
VDCLVIVCRHFDNILSIIKYEYKPNLIAILSRVFKQQMELPQSVPAISHL
FSSFSAFLEVMYDPYLTWRSFVRGQSADYSRLSYKPHSVHVEIVPFIYDC
FQEEKLIRYAEIGESLLNILGAVICGSQVAPESVSSPFLCSPFSLKNRLI
INLTS*

MIP13630.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10562-PA 1714 GF10562-PA 1..235 1..235 1098 84.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:50:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15204-PA 1724 GG15204-PA 1..235 1..235 1205 93.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:50:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15931-PA 1737 GH15931-PA 3..241 2..235 1005 75.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:50:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG43367-PC 2754 CG1308-PB 1..253 1..255 1205 92.5 Plus
CG43367-PD 2712 CG43367-PD 1..241 1..235 1203 95.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:50:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16580-PA 1730 GI16580-PA 1..240 1..235 1045 78 Plus
Dmoj\GI17590-PA 1405 GI17590-PA 1..199 1..235 825 64.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:50:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12834-PA 1446 GL12834-PA 36..205 66..235 718 77.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12030-PA 1728 GA12030-PA 1..241 1..235 1097 82.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14634-PA 1684 GM14634-PA 1..235 1..235 1219 95.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13822-PA 1716 GD13822-PA 1..235 1..235 1220 95.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12832-PA 1733 GJ12832-PA 1..240 1..235 1058 78.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12724-PA 1654 GK12724-PA 1..223 1..222 1017 82.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:50:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21422-PA 1716 GE21422-PA 1..235 1..235 1205 93.6 Plus

MIP13630.hyp Sequence

Translation from 292 to 1059

> MIP13630.hyp
MDNKKDIYNLWVQYTTKNDETHFRQFVARFVAIWRSQLQLDFQAENCPMW
HEVQPDSGPHLGRLPDELLPAIGKFIIVARDVCETEGKLEEQAIEEVAIL
VDCLVIVCRHFDNILSIIKYEYKPNLIAILSRVFKQQMELPQSVPAISHL
FSSFSAFLEVMYDPYLTWRSFVRGQSADYSRLSYKPHSVHVEIVPFIYDC
FQEEKLIRYAEIGESLLNILGAVICGSQVAPESVSSPFLCSPFSLKNRLI
INLTS*

MIP13630.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG43367-PC 2754 CG1308-PB 1..253 1..255 1205 92.5 Plus
CG43367-PD 2712 CG43367-PD 1..241 1..235 1203 95.9 Plus