Clone MIP13712 Report

Search the DGRC for MIP13712

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:137
Well:12
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG10866-RA
Protein status:MIP13712.pep: gold
Sequenced Size:1359

Clone Sequence Records

MIP13712.complete Sequence

1359 bp assembled on 2009-09-28

GenBank Submission: BT099897.1

> MIP13712.complete
CAAATATTGTGTGATATTTTTATGTGCGCACATCCATAACAAATATCCTT
GCAAATCGCCGGGAACACGACGAATTGCAGGTCAAGATGCCAGCAGTACG
TGGACATTACAGCAGCGAAGATTACGTGGAGCAGCAACAGCAGGAGGAGT
AAGTGCACACAGCGGAAGCAAGTAAATCCGTCCAATTGCCGAAAACCAGA
GCGTAGCCAGCCGGAAAAGTAGAGCAGACTCTCCCAGAAATCGATGCCCC
ACTGCCACACAATGGTCTATATGCGAATTGTGCTAACAACCTTGGTGACC
ATTACGTGTCTGCTGGGGGACAACTTTGTGGAGCTGACCCAGCATCCATT
GCTGAAGGCCCTGGCCGACAATGCCACCCATGCGGCCATTGGAGCACTCA
CGGGAATCACGTTCGCCACACAATTCTACGAGCGCACCTCGCAGTTGTTC
GGCTGGATATTGATTTTCACCTGCTTCGTTGTGTCATCGTTCATTGACTT
GGACCACTTTGTGGAGGCTCGTTCCCTTTATTTGGAGGATGCCACCAATC
TGTCGAAGAGGCCCTTCCTCCACTGCTCCAGCATTATAGTGGTTATGCTG
CTGTTCTACATGTGCACCGCCTGTTTGAACTATTTCCGGACCAGCCTAAT
GCTGGGATCCCTACTCTGTGCCTTCATCACACACCACACCAGGGACGCCG
TGCGGCGGGGCTACTGGCTGTGCCCGCTAGGTCACACGGACAGGATGCCC
CAGCTAGCCTACATATTGACCACCATCCTGACGCCCCATCTGCTGGGCTG
CCTGCACAACGTGTGCCGCAGCGCAACCGTGCTTAACTTCCTGGGGCAGT
ACGTCAAGCTAAGCGAGGGCCAATACCGCAGCGGCTCCACTGCCAACTAT
CGCTACATGCAGGTCTAGGCTATATGTAGGAACACTTTGTGATAATATTG
CAAAACATCATCAAATGGTAAATGCAAATTGCTTTTCAAGCTTCAAGCGC
TTTAAGATTAGAGATCGCCTAGAAACCCAAATACTTCCTCGCAACAGGAC
ACAATTTTACACGGATCTACTACTAGAAGTACCTTTTTGAGGGAACTATG
CTTCCCGTCCAATTGATTTTTCTTTGTTAAGTAGCGTGTAGGTTTTTACT
AGCATCTAACTAGAATACAGATAATATCCGGATATGTGATATGTAGTCCT
TAGACAAACTAGAGTAACGAGCATAGCGCACAACGATATCTAATCGATTT
TCAACTTCAACTCTGACTCTTGTAACTAGTAGGCCATACGAATTTTAAGC
TAATCGAATAATAAAATCAATCTAATTGCCTTACAACATCAAAAAAAAAA
AAAAAAAAA

MIP13712.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG10866-RA 1708 CG10866-RA 135..1478 1..1341 6650 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 03:23:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3935989..3936793 1340..536 3950 99.4 Minus
chr3L 24539361 chr3L 3936850..3937389 538..2 2575 98.9 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 03:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG10866-RB 675 CG10866-PB 1..675 244..918 3375 100 Plus
CG10866-RA 675 CG10866-PA 1..675 244..918 3375 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:15:00 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 03:22:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG10866-RB 1874 CG10866-RB 1..1343 1..1340 6635 99.8 Plus
CG10866-RA 1337 CG10866-RA 1..1337 1..1334 6605 99.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 03:22:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG10866-PB 224 CG10866-PB 1..224 244..915 1115 100 Plus
CG10866-PA 224 CG10866-PA 1..224 244..915 1115 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 03:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3936590..3937395 1341..536 4030 100 Minus
3L 28110227 3L 3937452..3937992 538..1 2625 99.4 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3936590..3937395 1341..536 4030 100 Minus
3L 28103327 3L 3937452..3937992 538..1 2635 99.4 Minus
Blast to na_te.dros performed on 2014-11-27 03:22:55 has no hits.

MIP13712.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 05:52:48 Download gff for MIP13712.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3936851..3937389 1..537 98   Minus
chr3L 3935989..3936791 538..1340 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:04 Download gff for MIP13712.complete
Subject Subject Range Query Range Percent Splice Strand
CG10866-RA 1..675 244..918 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:35:31 Download gff for MIP13712.complete
Subject Subject Range Query Range Percent Splice Strand
CG10866-RA 1..675 244..918 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:11:15 Download gff for MIP13712.complete
Subject Subject Range Query Range Percent Splice Strand
CG10866-RA 1..675 244..918 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:52:48 Download gff for MIP13712.complete
Subject Subject Range Query Range Percent Splice Strand
CG10866-RA 1..675 244..918 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 16:40:45 Download gff for MIP13712.complete
Subject Subject Range Query Range Percent Splice Strand
CG10866-RA 1..870 52..918 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:35:31 Download gff for MIP13712.complete
Subject Subject Range Query Range Percent Splice Strand
CG10866-RA 1..1286 52..1334 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:11:15 Download gff for MIP13712.complete
Subject Subject Range Query Range Percent Splice Strand
CG10866-RA 1..1286 52..1334 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:52:48 Download gff for MIP13712.complete
Subject Subject Range Query Range Percent Splice Strand
CG10866-RB 1..1343 1..1340 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 05:52:48 Download gff for MIP13712.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3937453..3937992 1..537 99   Minus
3L 3936591..3937393 538..1340 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:11:15 Download gff for MIP13712.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3937453..3937992 1..537 99   Minus
arm_3L 3936591..3937393 538..1340 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:19:05 Download gff for MIP13712.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3937453..3937992 1..537 99   Minus
3L 3936591..3937393 538..1340 100 <- Minus

MIP13712.pep Sequence

Translation from 243 to 917

> MIP13712.pep
MPHCHTMVYMRIVLTTLVTITCLLGDNFVELTQHPLLKALADNATHAAIG
ALTGITFATQFYERTSQLFGWILIFTCFVVSSFIDLDHFVEARSLYLEDA
TNLSKRPFLHCSSIIVVMLLFYMCTACLNYFRTSLMLGSLLCAFITHHTR
DAVRRGYWLCPLGHTDRMPQLAYILTTILTPHLLGCLHNVCRSATVLNFL
GQYVKLSEGQYRSGSTANYRYMQV*

MIP13712.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10251-PA 217 GF10251-PA 1..217 7..224 999 90.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14237-PA 203 GG14237-PA 1..203 7..224 934 84.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15711-PA 225 GH15711-PA 1..225 7..224 949 81.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:55:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG10866-PB 224 CG10866-PB 1..224 1..224 1189 100 Plus
CG10866-PA 224 CG10866-PA 1..224 1..224 1189 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:55:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12766-PA 218 GI12766-PA 1..218 7..224 980 85.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16201-PA 227 GL16201-PA 1..227 7..224 1020 85.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10608-PA 227 GA10608-PA 1..227 7..224 1020 85.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14029-PA 218 GM14029-PA 1..218 7..224 1150 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:56:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13310-PA 107 GD13310-PA 1..107 118..224 570 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16107-PA 222 GJ16107-PA 1..220 7..223 974 83.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:56:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16695-PA 205 GK16695-PA 1..202 7..208 983 90.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:56:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20665-PA 218 GE20665-PA 1..218 7..224 1142 99.1 Plus

MIP13712.hyp Sequence

Translation from 243 to 917

> MIP13712.hyp
MPHCHTMVYMRIVLTTLVTITCLLGDNFVELTQHPLLKALADNATHAAIG
ALTGITFATQFYERTSQLFGWILIFTCFVVSSFIDLDHFVEARSLYLEDA
TNLSKRPFLHCSSIIVVMLLFYMCTACLNYFRTSLMLGSLLCAFITHHTR
DAVRRGYWLCPLGHTDRMPQLAYILTTILTPHLLGCLHNVCRSATVLNFL
GQYVKLSEGQYRSGSTANYRYMQV*

MIP13712.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:10:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG10866-PB 224 CG10866-PB 1..224 1..224 1189 100 Plus
CG10866-PA 224 CG10866-PA 1..224 1..224 1189 100 Plus