Clone MIP13816 Report

Search the DGRC for MIP13816

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:138
Well:16
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG11498-RB
Protein status:MIP13816.pep: gold
Sequenced Size:2525

Clone Sequence Records

MIP13816.complete Sequence

2525 bp assembled on 2009-09-28

GenBank Submission: BT099876.1

> MIP13816.complete
CGATCGGTCGTGCTCCGCTCCTCGCGTTTTTCCAGTTTCACTTCCAGTGT
CGATTTTTCACTGTTGGAGGCGCGTGCTTAAACGGTAAACAGCGAGAAGA
ATCGGTCGGAAGAAGAGTGAGGCCGGGAAGACTGAAGACTGACAGCCTCT
TCGCGGAGACGAGGAATTTCCCGTGGCATTTGCCACCCAAATGTTAGACG
AGTTAATGAAGTGCAAAAATGTTTGTCGACTGAGTTGTTGCTGCTGCCAA
ATGAACACGAAGGCGCCGTCAACTTTGTGATTTGCGGTTGCATTCTGCAG
AAGATACAAGCTCCGGCTCGGGCAATCTCAAGACCCTAGAAAAAGACAGC
CTGTGGTTTTTGACCCTGTCGCTTTCGGCAGCAAAGTGAAAATTGCTCGG
CAGCCGAGGAAAAGCGGAAAATCTGCGACTTCTTCTGCGGTGTCAAGTGA
GAAGACGACCTGGCGATTCTCCTGCGGATTAGTGGCACACTTACCCACAA
CCAGCACCGTTGAAAACCATAGCCCTCCCTCGGAGTTGGAGACCAGAGAG
CCCAAACGCACCGTCATGGAACCCACGCCCACACCCAATATGCTGTAAGC
AGTCCCACTGAACTTGCATCTTAGACTCCGCATCCGCATCTACATCTGCA
TCTGATCTGCATCTCACTGACTTCGCATCTGCATCTGTACAAAGCCATTC
CATTAACCCACAACCGAGTAACCAGAGTAATCCGCATCTCCAACGACTCC
AGCAAGCAGATCCTGCTGAAGAATCATCAGGACGCTATTCTGCAGCTCCA
CGGTCATTCTCCGTCGCTTCCCCTGTCCTTTGGCGCCGCATCGATGGCGG
ACAGCAGGGAACGGATTCGTGGACCCTCCAGGGATGGTCGCGAGTTCCTG
ACCAGTCCGCGTCAGGTTCTTCGTCGGCTGATGCTCCTCTCGGAGGGCAG
ACAGTACAGGGAGGCTGCTGGCGTGGTGGGCAGACTGGGTCCCTCGGTTC
TCAGATCAGTGATCGCTGAGCTTCCGCTGGACCTGCTGCTGGAGCACCTG
CCTCACAGTGCCTACCTTCTGGAGTCTTTCTTTACCAGATTGACCACCCT
GAACACCACTCCCAAGCCAGATGTGCCTAGTGAAACGGTGGCCTGGCAGT
TGGTGCGTCTGTTCGCTAATCCCCATGAATCAGGACTCCGGCAGAGATGC
ACTCGACTCCTGCAGGCCTTGGCTCAGTACGAACCAGGGCTCCGGCAGAC
TTTGAGGGAAAGAAGACGCAGTTTTGATAACGCTGTACAAGGTCTTGGGG
TCCATGGACTGACCACCGATGCCTCGGGTCAGCTTATTTCCCTACATGTA
GCCCTGAAAACCGAGCTGCAACGCCATGTGGATACCTACAAGATGGCCAT
TCACAAGCTGGAGGAGCTGAGCATGGTGACTGTCAACCAAGACCCTGCTC
ACTCCTCCCATCAACGATTGTTGGCCATCAATTATGGGGATATTCAGCAG
CGACTGATCGACAACAAGACCCTGCTCACAATGCTAGACAAGCCGGCTCT
CAAGCAGCTCCAAACCCTGGTCGAGAACCTCAGCACGCGGGTGGAGAACG
ACAAGGAGGTGCTCACCTGCGTGGGTCAGGTGCGTCGTCTGGACGCACAG
GCGCTCGTGGAGAAACGCCCTGCCGCCGGTCTGCTGATGAACTTCTCCCG
CGGCTGCGAGGTGGTGCTCCACATGATGGGCCCTGAAGGAGGTCCTCCGG
GCTCCTCCCACTCCATTGGAAAGACCACTCCCCCAGGCGGCGCTAGCACG
AGCAGCTGCAGCGATGGATATCACTCGGACGACTCTGGAAGCGATGACAG
CAGCGAAATGGTGTCGCTCTATCGGAATCTCTACGTCGAGAACCGAGCGG
ACGCCTTGGAGGCGTTGGACAGTCTTCCCCAGATAAAACACGCGCACAGC
CTCAAGGGGAAGATACTCTTCTCCATGATCGTGCTCTCCTTCCGCCTGTG
CCACGGAATGCGGGAGCGAAAGGTCCTGGAAGTTCGGCGAGTCCTGAATT
GCCCCTTGGACAGCAGCAGTGAGACCACCTTGTCCCTGGACAGATCCGTT
CGCCAGCACCTCTTCGAGACCGCCGAGAGTTTCCCGTTGGGCGAGATCGA
GCGGTCGGTGTTCAACCAGGTGCTATCTACTCTGCACGAGTACCCCTGCC
TGGAGTCCTGCCCCCCGTTGACGCACTACGTCAGTGCCTGTGTCCGACTG
GCCTGGAGGATGATCAACCAGAAGGCGCCGTACTACCTGGACATGGACTT
CAACCTGGGTTTCCTGAGGCCCGAGAAACACGAGCGGCATCCCCAGGCGG
ACCGGCGATCGGATCTGATAAAAGCCTTCCTCTGGCCCGCCCTGATGCAG
AACAACCAGTGCGCCTTCAAGGCGGTGGTGGCCACCTGAGCATCGTCTTA
AGCTAACCCCATTTGTACATACTTGCCCTCTCTTATGCAATAAAGATTTG
ACCCCTAAAAAAAAAAAAAAAAAAA

MIP13816.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG11498-RA 1903 CG11498-RA 65..1423 625..1983 6795 100 Plus
CG11498-RA 1903 CG11498-RA 1448..1903 1984..2439 2280 100 Plus
CG15529-RA 1194 CG15529-RA 920..1119 2507..2308 1000 100 Minus
CG15529.a 1407 CG15529.a 1153..1352 2507..2308 1000 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25977495..25978262 1853..1086 3840 100 Minus
chr3R 27901430 chr3R 25978351..25978918 1088..521 2840 100 Minus
chr3R 27901430 chr3R 25982411..25982930 520..1 2585 99.8 Minus
chr3R 27901430 chr3R 25975715..25976042 2310..1983 1640 100 Minus
chr3R 27901430 chr3R 25975458..25975656 2506..2308 995 100 Minus
chr3R 27901430 chr3R 25977190..25977322 1983..1851 665 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:04:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG11498-RC 1596 CG11498-PC 1..1596 844..2439 7980 100 Plus
CG11498-RB 1596 CG11498-PB 1..1596 844..2439 7980 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:15:12 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG11498-RB 2506 CG11498-RB 1..2506 1..2506 12530 100 Plus
CG11498-RC 2348 CG11498-RC 595..2348 753..2506 8770 100 Plus
CG11498-RC 2348 CG11498-RC 1..594 1..594 2970 100 Plus
CG15529-RB 1393 CG15529-RB 973..1300 2310..1983 1640 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:04:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG11498-PC 531 CG11498-PC 1..526 844..2421 2275 100 Plus
CG11498-PB 531 CG11498-PB 1..526 844..2421 2275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:04:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30155059..30155826 1853..1086 3840 100 Minus
3R 32079331 3R 30155915..30156482 1088..521 2840 100 Minus
3R 32079331 3R 30159954..30160473 520..1 2600 100 Minus
3R 32079331 3R 30153279..30153606 2310..1983 1640 100 Minus
3R 32079331 3R 30153021..30153220 2507..2308 1000 100 Minus
3R 32079331 3R 30154754..30154886 1983..1851 665 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29895890..29896657 1853..1086 3840 100 Minus
3R 31820162 3R 29896746..29897313 1088..521 2840 100 Minus
3R 31820162 3R 29900785..29901304 520..1 2600 100 Minus
3R 31820162 3R 29894110..29894437 2310..1983 1640 100 Minus
3R 31820162 3R 29893852..29894051 2507..2308 1000 100 Minus
3R 31820162 3R 29895585..29895717 1983..1851 665 100 Minus
Blast to na_te.dros performed on 2014-11-27 05:04:05 has no hits.

MIP13816.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:27:29 Download gff for MIP13816.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25982411..25982930 1..520 99   Minus
chr3R 25978810..25978918 521..629 100 <- Minus
chr3R 25978351..25978751 688..1088 100 == Minus
chr3R 25977495..25978259 1089..1853 100 <- Minus
chr3R 25977190..25977319 1854..1983 100 <- Minus
chr3R 25975717..25976041 1984..2308 100 <- Minus
chr3R 25975458..25975655 2309..2506 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:49 Download gff for MIP13816.complete
Subject Subject Range Query Range Percent Splice Strand
CG11498-RA 1..1137 844..1980 100 -> Plus
CG11498-RA 1160..1620 1981..2439 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:46 Download gff for MIP13816.complete
Subject Subject Range Query Range Percent Splice Strand
CG11498-RB 1..1596 844..2439 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:35:15 Download gff for MIP13816.complete
Subject Subject Range Query Range Percent Splice Strand
CG11498-RB 1..1596 844..2439 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:27:29 Download gff for MIP13816.complete
Subject Subject Range Query Range Percent Splice Strand
CG11498-RB 1..1596 844..2439 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 11:41:39 Download gff for MIP13816.complete
Subject Subject Range Query Range Percent Splice Strand
CG11498-RA 58..1420 617..1980 99 -> Plus
CG11498-RA 1443..1903 1981..2439 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:46 Download gff for MIP13816.complete
Subject Subject Range Query Range Percent Splice Strand
CG11498-RB 1..2506 1..2506 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:35:15 Download gff for MIP13816.complete
Subject Subject Range Query Range Percent Splice Strand
CG11498-RB 1..2506 1..2506 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:27:29 Download gff for MIP13816.complete
Subject Subject Range Query Range Percent Splice Strand
CG11498-RB 1..2506 1..2506 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:27:29 Download gff for MIP13816.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30159954..30160473 1..520 100   Minus
3R 30155915..30156482 521..1088 100 <- Minus
3R 30155059..30155823 1089..1853 100 <- Minus
3R 30154754..30154883 1854..1983 100 <- Minus
3R 30153281..30153605 1984..2308 100 <- Minus
3R 30153022..30153219 2309..2506 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:35:15 Download gff for MIP13816.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25985676..25986195 1..520 100   Minus
arm_3R 25981637..25982204 521..1088 100 <- Minus
arm_3R 25980781..25981545 1089..1853 100 <- Minus
arm_3R 25980476..25980605 1854..1983 100 <- Minus
arm_3R 25979003..25979327 1984..2308 100 <- Minus
arm_3R 25978744..25978941 2309..2506 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:35 Download gff for MIP13816.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29900785..29901304 1..520 100   Minus
3R 29896746..29897313 521..1088 100 <- Minus
3R 29895890..29896654 1089..1853 100 <- Minus
3R 29895585..29895714 1854..1983 100 <- Minus
3R 29894112..29894436 1984..2308 100 <- Minus
3R 29893853..29894050 2309..2506 100 <- Minus

MIP13816.pep Sequence

Translation from 843 to 2438

> MIP13816.pep
MADSRERIRGPSRDGREFLTSPRQVLRRLMLLSEGRQYREAAGVVGRLGP
SVLRSVIAELPLDLLLEHLPHSAYLLESFFTRLTTLNTTPKPDVPSETVA
WQLVRLFANPHESGLRQRCTRLLQALAQYEPGLRQTLRERRRSFDNAVQG
LGVHGLTTDASGQLISLHVALKTELQRHVDTYKMAIHKLEELSMVTVNQD
PAHSSHQRLLAINYGDIQQRLIDNKTLLTMLDKPALKQLQTLVENLSTRV
ENDKEVLTCVGQVRRLDAQALVEKRPAAGLLMNFSRGCEVVLHMMGPEGG
PPGSSHSIGKTTPPGGASTSSCSDGYHSDDSGSDDSSEMVSLYRNLYVEN
RADALEALDSLPQIKHAHSLKGKILFSMIVLSFRLCHGMRERKVLEVRRV
LNCPLDSSSETTLSLDRSVRQHLFETAESFPLGEIERSVFNQVLSTLHEY
PCLESCPPLTHYVSACVRLAWRMINQKAPYYLDMDFNLGFLRPEKHERHP
QADRRSDLIKAFLWPALMQNNQCAFKAVVAT*

MIP13816.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:45:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16199-PA 569 GF16199-PA 39..569 1..531 2595 95.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11960-PA 603 GG11960-PA 73..603 1..531 2810 99.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18389-PA 561 GH18389-PA 30..561 1..531 2563 89.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:45:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG11498-PC 531 CG11498-PC 1..531 1..531 2734 100 Plus
CG11498-PB 531 CG11498-PB 1..531 1..531 2734 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:46:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23380-PA 561 GI23380-PA 32..561 1..531 2555 90.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:46:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14067-PA 495 GL14067-PA 1..495 1..531 2247 85.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11034-PA 528 GA11034-PA 1..528 1..531 2462 91.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12177-PA 531 GM12177-PA 1..531 1..531 2796 98.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17300-PA 638 GD17300-PA 108..638 1..531 2800 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:46:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10375-PA 530 GJ10375-PA 1..530 1..531 2534 91 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:46:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13149-PA 527 GK13149-PA 1..527 1..531 2450 91.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:46:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23409-PA 581 GE23409-PA 41..581 1..531 2652 97.4 Plus

MIP13816.hyp Sequence

Translation from 843 to 2438

> MIP13816.hyp
MADSRERIRGPSRDGREFLTSPRQVLRRLMLLSEGRQYREAAGVVGRLGP
SVLRSVIAELPLDLLLEHLPHSAYLLESFFTRLTTLNTTPKPDVPSETVA
WQLVRLFANPHESGLRQRCTRLLQALAQYEPGLRQTLRERRRSFDNAVQG
LGVHGLTTDASGQLISLHVALKTELQRHVDTYKMAIHKLEELSMVTVNQD
PAHSSHQRLLAINYGDIQQRLIDNKTLLTMLDKPALKQLQTLVENLSTRV
ENDKEVLTCVGQVRRLDAQALVEKRPAAGLLMNFSRGCEVVLHMMGPEGG
PPGSSHSIGKTTPPGGASTSSCSDGYHSDDSGSDDSSEMVSLYRNLYVEN
RADALEALDSLPQIKHAHSLKGKILFSMIVLSFRLCHGMRERKVLEVRRV
LNCPLDSSSETTLSLDRSVRQHLFETAESFPLGEIERSVFNQVLSTLHEY
PCLESCPPLTHYVSACVRLAWRMINQKAPYYLDMDFNLGFLRPEKHERHP
QADRRSDLIKAFLWPALMQNNQCAFKAVVAT*

MIP13816.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:13:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG11498-PC 531 CG11498-PC 1..531 1..531 2734 100 Plus
CG11498-PB 531 CG11498-PB 1..531 1..531 2734 100 Plus