Clone MIP13919 Report

Search the DGRC for MIP13919

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:139
Well:19
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG12402-RA
Protein status:MIP13919.pep: gold
Sequenced Size:3543

Clone Sequence Records

MIP13919.complete Sequence

3543 bp assembled on 2009-11-04

GenBank Submission: BT100254.1

> MIP13919.complete
CAGCGGCGGCAGCAGGTTGCTGTCGAATTGGAAAAGAAAATCGCTGAAAT
TAATTGAAAATTTGTTTATATCATTCACAATTACCGAGAGTGTTAGTAGG
CAGCTAAAGTCAAAGAAAATTCAATCGTACAATCGCACAAATACGCAAAT
CAAGGAAAGAACGCAATGCATACAGCATTTAATAAAAAAAAAGAAAACAA
AGGGATAAATTGTGCCAAACAGCAATGAAATGTGTTTACAGACAATACAT
ATAACAGAGTTTTAATTATAACCGCTTAAAGTTTGAAATAATTACAAAAT
ATGTAATAATTCGAGCCAGAATAATAGCGCAATAACGTATAGACAGCACA
TATTATGTTAAAACAAGTTCCCACAATACATATGTAAGCAATTAATAACA
TTTTTGACAATCCATGGCAAGGTTGTAACCAAAACTCTGAAAGAAAATAC
TCAAAAAATTCAGTGACTTCATCGGAAAGAAGGTTGAGATTGAATTGAGT
TGCTGCATGGGGAATAGTCTGATAACGAGTGGAAAACCGAGTCAGCGCCG
TGAAAAGAGGCTTTTCGAGAGGCTGAGCTGCAGCTACGCTCAGACCCCCA
ACAGAATGGAGTTGAACTTGAATCCCCTGCTGGCCATCGCCCGTTCCATT
GCGGCGCCACCGACACCGCCTCCAACCCCGGAAAAGTTGGACTCGGATAA
GGATAAGGAGGGTTCCTCCAAAGCCGCCATCGAACTGCTGCCTAACGAGA
TGTGGCTAGAGATCATGTCCTACCTTTCGTACAATGACCTGCTGCAATTG
CGGATGGTGTCCTGGCGGTGCCGTGATCTGGTTCATCGTCGTCGATTCAT
GGAGAAAGGGAAGGTGATAGTGACGCAACACAACCTGGAGGCGATCCACA
AGCATGCGAAGGGCGGAAATTGCTATTTGAGCTTCGAGCGGATTGAATTA
AGAAATCTACGCCAGTGCCGCCAGTTGGAGAACTTTCTGCGTCTTGTGGG
CCACGAAGTGAAGCATCTGCAAGTGCGCCATGCTCCTGTTTTCCGGAATC
TGGATGGCAAGTTACCAAACCTTAAGGTTCTGACCATTGCCACGACTATG
TCGATGGATGACCAGCATCTGGCGGCGATGGATGACCTGGATATGAAGCA
GTTTTCCCACCTTGTGGGATTCGAATGCGATGGCGTGAGTTTGGACGCGG
TGCTTAAGATGCGAATGTTGTTGCAGCTGCGACGAACGGAGAACAAGGTG
CAACTGCGGCACCTGCAATTCGAATTCCGGCGGAACAACGAAAATGCTCT
GCTGGATGTCCTACAGGATCATGCGGAAACCTTGGTGTGCGTCAATTTAT
TCTTCAGCTGCTCGCCGGGCATTGATACGCGTGAATGGTGCCGAGCGTTC
GAAAATATGCACAATCTGCGAACTCTCAAGCTTTCGGGAAATTGTCATCT
GGTCCTGTTGGAAGCTGTCCTAAGAGCCGTTCCGGAGTCAGCACCAATCC
GTCAACTGGATTTGACCGGAATGTTATCGCTAACCAACGAATTACTGCTC
TATGTAGCTGGCAAGTGGCAAAGCACTCTGAAGGTGCTCGATCTAATGTT
TTGTGTCCAACTCAACGCCAATTGCATTGATGCACTGCGCCAGCTGAGTG
GTCGGTTGGAGGCACTGACCATGGCTTACTGCAGAGAGCTGACTGGAACG
GGTTTGCTTCAAGGGCTGGCCGGCGATATTAACTACAGCCTGCAGGAGCT
GCATCTGGAGGAAACCATATTTTTGGACGAGAGCTCCATGTGCCAGCTGC
TGGAGCGACTGCCCAATCTTCGACGCCTCAGTTTGGATAACTGCCGCCAA
GCGGTGACGGATCGCACAATGGCCACCATTTGCCAATACCAGACAAGACT
GAGAAATCTTAACATCGAATACTGTATGAAGATTACGGATCAAGGCCTGA
TGGGATATGGAGACACTCCCTATCCTATAAGTCGACTACGCGGATTGAAG
GAACTTAACCTTAGGGGCTGTCGCAATGTCACGGATAGTTCTCTAATGGT
TGGGCTGAAATTACCAGAGCTACGAGCCCTATCTTTGGGCTACTGCAACC
GTCTCACTTCAGAGGGATTTGAGGCATTGACCCAAAACTGTCCATCCCTG
GAGGCACTTTGTGTGTCCAGTTGCATGGCAGTGGATGATGAGACTGTACT
CAATATAGTAAGCAATCTAAAGCGTTTGCGAGTTCTCAACCTGAGCAACT
GCACCAAGTTGACCCTGCAATCGATCCACCACATTCTGGCGCATGGACAC
AATCTAGTCCAGCTGATCGCCTGCTCCATAGACGGCATGGATCATGAGCA
GGCCCAGCGCATTCTAGAGTCGCAGCGACCACAAATGAAGCAGGTGCTTC
TATAGCAGGAGAGGTATATCCACTGACGGAGCCGAAACACACCCCATCAC
AACGATTGGGGGAACCACGAGGATGATGAGTTCGACGACGATGAGACCGA
GATAATCGAGATCGTAGTTTAGTCGCTCGTAAGACGATTAGATTAAGAGG
CAGCTGAGCGTCAAACGTACATTGATTTATCCGTTAGGAAATTATTTTAG
ACCCTGAACACTTTGGGAAAAAAAACTTTAGAGGTGATACTTAGATTTTT
TTAAAGCCCCATCCGATTGCTATTTTAAGATCAGCCAACAACAGAAGCCA
AAAAAGAAAGTACAAGTATTCATCCCACCCAAAAACCAACTTTAACATTT
CAGCGAGTAACCATTAATTTTTAAGCAATCATGAAACTCCATGCGATTGC
CATCAATAACGATATAACCATTTATTTTAAAGGTATCTTTAAACATCATA
CTACGGTCAGCAGAGCTTTTAATTTCAAAGAATCGAGCAATACCAACAAG
TAAAGACTTTATCCTAAACTTTACTTATACGTAATCTAAGGCCATATGAA
GGAGCCCAAGGAGCTTGCATTTCTATACACCTATTAATCGGGTTAATCAA
CGAAACAATACATCTACAAATAATACTTTGAGTGTTGTTCAAGTCAATAT
ATTAATCAGAGTGTGTCTACAATTTTTATATCTTACGTAGCATAACTATA
CGGTTGATAAACATATTCAAGGAACGAGTTGCGAAAAGAGGCTGTTAGAA
TAAGTGGGATGTTCAAATCTAACCAACCAATATATGATATATTTTAATTC
ATAGATGTAAGAAGTTTTCAGAAAAGTTTTAAAAGAAATCGTTGGATTTA
GGTATAAGGGAAGCAAGACTCTCCCGATAAGAAAGAACGGAACTTTTGGA
ATATATATTCTTTTGAAGAATTTTACTTTACTTAATCAACTTAAAACATT
TAATAAATGTTTGCGTGTGTTATATGCTAATCGGAACGATGGTAGAGGAC
TTAACATAAGATGCGTTCTACGTATAAAAGATATTCAGCTTCTTTTGAAG
AAATCTAATAAATACTAAATAAATGGAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP13919.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:42:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG12402.a 3519 CG12402.a 42..3518 1..3477 17355 99.9 Plus
CG12402-RA 3519 CG12402-RA 42..3518 1..3477 17355 99.9 Plus
CG12402.b 3313 CG12402.b 1..3312 166..3477 16530 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:57:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9929358..9930948 3476..1886 7805 99.4 Minus
chr3R 27901430 chr3R 9931012..9932305 1885..592 6455 99.9 Minus
chr3R 27901430 chr3R 9932599..9933182 593..1 2735 97.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:57:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG12402-RC 2016 CG12402-PC 1..2016 507..2522 10080 100 Plus
CG12402-RB 1920 CG12402-PB 1..1920 507..2426 9600 100 Plus
CG12402-RA 1899 CG12402-PA 1..1899 507..2405 9495 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:15:26 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:57:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG12402-RC 3476 CG12402-RC 1..3476 1..3476 17350 99.9 Plus
CG12402-RB 3476 CG12402-RB 1..3476 1..3476 17350 99.9 Plus
CG12402-RA 3476 CG12402-RA 1..3476 1..3476 17350 99.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:57:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG12402-PC 671 CG12402-PC 1..654 507..2468 3256 99.7 Plus
CG12402-PB 639 CG12402-PB 1..639 507..2423 3169 99.8 Plus
CG12402-PA 632 CG12402-PA 1..632 507..2402 3139 100 Plus
CG8272-PA 689 CG8272-PA 530..635 1977..2294 233 42.5 Plus
CG8272-PB 710 CG8272-PB 530..635 1977..2294 233 42.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:57:02
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 14104482..14106078 3482..1886 7940 99.8 Minus
3R 32079331 3R 14106142..14107435 1885..592 6470 100 Minus
3R 32079331 3R 14107729..14108321 593..1 2965 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:39:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13845313..13846909 3482..1886 7940 99.8 Minus
3R 31820162 3R 13846973..13848266 1885..592 6470 100 Minus
3R 31820162 3R 13848560..13849152 593..1 2965 100 Minus
Blast to na_te.dros performed on 2014-11-27 09:57:03 has no hits.

MIP13919.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:53:49 Download gff for MIP13919.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9932599..9933182 1..593 97   Minus
chr3R 9931012..9932303 594..1885 99 <- Minus
chr3R 9929358..9930948 1886..3476 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-04 13:27:37 Download gff for MIP13919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12402-RA 1..1899 507..2405 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:17:30 Download gff for MIP13919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12402-RA 1..1899 507..2405 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:01:04 Download gff for MIP13919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12402-RB 1..1920 507..2426 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:53:49 Download gff for MIP13919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12402-RC 1..2016 507..2522 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-04 13:27:36 Download gff for MIP13919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12402-RA 1..2585 507..3091 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:17:30 Download gff for MIP13919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12402-RA 1..2926 166..3091 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:01:04 Download gff for MIP13919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12402-RA 1..3476 1..3476 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:53:49 Download gff for MIP13919.complete
Subject Subject Range Query Range Percent Splice Strand
CG12402-RA 1..3476 1..3476 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:53:49 Download gff for MIP13919.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14107729..14108321 1..593 100   Minus
3R 14106142..14107433 594..1885 100 <- Minus
3R 14104488..14106078 1886..3476 99 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:01:04 Download gff for MIP13919.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9933451..9934043 1..593 100   Minus
arm_3R 9931864..9933155 594..1885 100 <- Minus
arm_3R 9930210..9931800 1886..3476 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:06:58 Download gff for MIP13919.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13848560..13849152 1..593 100   Minus
3R 13846973..13848264 594..1885 100 <- Minus
3R 13845319..13846909 1886..3476 99 <- Minus

MIP13919.pep Sequence

Translation from 506 to 2404

> MIP13919.pep
MGNSLITSGKPSQRREKRLFERLSCSYAQTPNRMELNLNPLLAIARSIAA
PPTPPPTPEKLDSDKDKEGSSKAAIELLPNEMWLEIMSYLSYNDLLQLRM
VSWRCRDLVHRRRFMEKGKVIVTQHNLEAIHKHAKGGNCYLSFERIELRN
LRQCRQLENFLRLVGHEVKHLQVRHAPVFRNLDGKLPNLKVLTIATTMSM
DDQHLAAMDDLDMKQFSHLVGFECDGVSLDAVLKMRMLLQLRRTENKVQL
RHLQFEFRRNNENALLDVLQDHAETLVCVNLFFSCSPGIDTREWCRAFEN
MHNLRTLKLSGNCHLVLLEAVLRAVPESAPIRQLDLTGMLSLTNELLLYV
AGKWQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYCRELTGTGL
LQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCRQAV
TDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKEL
NLRGCRNVTDSSLMVGLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEA
LCVSSCMAVDDETVLNIVSNLKRLRVLNLSNCTKLTLQSIHHILAHGHNL
VQLIACSIDGMDHEQAQRILESQRPQMKQVLL*

MIP13919.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:05:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18791-PA 625 GF18791-PA 1..625 1..632 2452 72 Plus
Dana\GF12565-PA 689 GF12565-PA 346..635 383..596 227 26.5 Plus
Dana\GF13252-PA 492 GF13252-PA 232..489 318..581 187 25.5 Plus
Dana\GF11789-PA 637 GF11789-PA 290..592 295..608 178 24.1 Plus
Dana\GF18550-PA 771 GF18550-PA 491..744 318..582 178 26.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21523-PA 638 GG21523-PA 1..638 1..632 3078 92.8 Plus
Dere\GG10616-PA 689 GG10616-PA 528..635 489..596 218 40.7 Plus
Dere\GG20101-PA 538 GG20101-PA 226..488 318..586 202 25.7 Plus
Dere\GG20101-PA 538 GG20101-PA 254..533 296..580 196 27.9 Plus
Dere\GG16963-PA 778 GG16963-PA 508..751 358..582 180 28.7 Plus
Dere\GG22638-PA 641 GG22638-PA 298..457 438..603 178 30.4 Plus
Dere\GG10616-PA 689 GG10616-PA 190..439 301..586 158 25.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:05:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23757-PA 594 GH23757-PA 28..594 66..632 1769 60.4 Plus
Dgri\GH19700-PA 581 GH19700-PA 15..581 66..632 1767 60.4 Plus
Dgri\GH22692-PA 674 GH22692-PA 402..623 357..596 231 33.5 Plus
Dgri\GH22100-PA 550 GH22100-PA 238..531 318..612 200 25 Plus
Dgri\GH22100-PA 550 GH22100-PA 271..545 300..580 185 27.1 Plus
Dgri\GH23468-PA 766 GH23468-PA 496..739 358..582 178 27.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:05:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG12402-PC 671 CG12402-PC 1..632 1..632 3270 100 Plus
CG12402-PB 639 CG12402-PB 1..632 1..632 3270 100 Plus
CG12402-PA 632 CG12402-PA 1..632 1..632 3270 100 Plus
CG8272-PA 689 CG8272-PA 14..635 78..596 253 22.3 Plus
CG8272-PB 710 CG8272-PB 14..635 78..596 253 22.3 Plus
CG8272-PA 689 CG8272-PA 294..675 187..585 165 21.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:05:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24556-PA 615 GI24556-PA 31..615 60..632 1870 61.8 Plus
Dmoj\GI20620-PA 678 GI20620-PA 14..624 78..596 239 23.7 Plus
Dmoj\GI19235-PA 545 GI19235-PA 233..526 318..612 205 25.1 Plus
Dmoj\GI19235-PA 545 GI19235-PA 262..540 297..580 193 27.7 Plus
Dmoj\GI21037-PA 677 GI21037-PA 334..649 304..628 180 23.3 Plus
Dmoj\GI22952-PA 782 GI22952-PA 502..755 318..582 176 26.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:05:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23311-PA 625 GL23311-PA 1..625 1..632 2172 66 Plus
Dper\GL17357-PA 665 GL17357-PA 7..611 71..596 288 25.4 Plus
Dper\GL10712-PA 529 GL10712-PA 217..479 318..586 201 24.9 Plus
Dper\GL10712-PA 529 GL10712-PA 246..524 297..580 190 27.4 Plus
Dper\GL22080-PA 789 GL22080-PA 509..762 318..582 176 26.5 Plus
Dper\GL10673-PA 633 GL10673-PA 286..605 295..628 161 22.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:05:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11611-PA 625 GA11611-PA 1..625 1..632 2181 66.1 Plus
Dpse\GA20946-PA 686 GA20946-PA 525..632 489..596 218 42.6 Plus
Dpse\GA22149-PA 529 GA22149-PA 217..479 318..586 201 24.9 Plus
Dpse\GA22149-PA 529 GA22149-PA 246..524 297..580 190 27.4 Plus
Dpse\GA18044-PA 787 GA18044-PA 507..760 318..582 176 26.5 Plus
Dpse\GA21468-PA 632 GA21468-PA 285..604 295..628 162 22.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25887-PA 632 GM25887-PA 1..632 1..632 3165 95.9 Plus
Dsec\GM20660-PA 689 GM20660-PA 528..635 489..596 219 40.7 Plus
Dsec\GM15616-PA 538 GM15616-PA 226..488 318..586 201 25.3 Plus
Dsec\GM15616-PA 538 GM15616-PA 254..533 296..580 196 27.9 Plus
Dsec\GM24270-PA 772 GM24270-PA 502..745 358..582 179 28.3 Plus
Dsec\GM20416-PA 653 GM20416-PA 310..469 438..603 178 30.4 Plus
Dsec\GM20416-PA 653 GM20416-PA 310..625 331..628 161 23.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:05:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20458-PA 632 GD20458-PA 1..632 1..632 3182 96.7 Plus
Dsim\GD10134-PA 689 GD10134-PA 528..635 489..596 213 39.8 Plus
Dsim\GD25110-PA 522 GD25110-PA 273..517 331..580 189 28 Plus
Dsim\GD19058-PA 772 GD19058-PA 502..745 358..582 178 28.3 Plus
Dsim\GD25892-PA 615 GD25892-PA 272..431 438..603 177 29.8 Plus
Dsim\GD25110-PA 522 GD25110-PA 273..472 384..586 173 26 Plus
Dsim\GD25110-PA 522 GD25110-PA 245..443 410..582 172 26 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:05:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22622-PA 596 GJ22622-PA 40..596 75..632 1872 64.7 Plus
Dvir\GJ21060-PA 678 GJ21060-PA 14..624 78..596 227 24.6 Plus
Dvir\GJ20310-PA 542 GJ20310-PA 230..523 318..612 205 25 Plus
Dvir\GJ20310-PA 542 GJ20310-PA 259..537 297..580 194 27.7 Plus
Dvir\GJ21964-PA 660 GJ21964-PA 317..468 438..595 177 30 Plus
Dvir\GJ23768-PA 780 GJ23768-PA 500..753 318..582 172 26.5 Plus
Dvir\GJ21964-PA 660 GJ21964-PA 317..632 304..628 168 23 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:05:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10909-PA 641 GK10909-PA 1..641 1..632 2194 65.4 Plus
Dwil\GK20942-PA 680 GK20942-PA 519..626 489..596 236 43.5 Plus
Dwil\GK21848-PA 543 GK21848-PA 231..516 318..607 205 24.7 Plus
Dwil\GK21848-PA 543 GK21848-PA 260..538 297..580 195 28 Plus
Dwil\GK11217-PA 764 GK11217-PA 485..737 318..582 187 27.5 Plus
Dwil\GK21630-PA 634 GK21630-PA 291..606 304..628 168 23 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:05:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10063-PA 638 GE10063-PA 1..638 1..632 3025 93.4 Plus
Dyak\GE22768-PA 689 GE22768-PA 347..635 304..596 219 28.9 Plus
Dyak\GE11843-PA 533 GE11843-PA 221..483 318..586 201 25.8 Plus
Dyak\GE11843-PA 533 GE11843-PA 249..528 296..580 196 27.9 Plus
Dyak\GE24351-PA 780 GE24351-PA 500..753 318..582 180 26.9 Plus
Dyak\GE13509-PA 640 GE13509-PA 297..456 438..603 178 30.4 Plus

MIP13919.hyp Sequence

Translation from 506 to 2404

> MIP13919.hyp
MGNSLITSGKPSQRREKRLFERLSCSYAQTPNRMELNLNPLLAIARSIAA
PPTPPPTPEKLDSDKDKEGSSKAAIELLPNEMWLEIMSYLSYNDLLQLRM
VSWRCRDLVHRRRFMEKGKVIVTQHNLEAIHKHAKGGNCYLSFERIELRN
LRQCRQLENFLRLVGHEVKHLQVRHAPVFRNLDGKLPNLKVLTIATTMSM
DDQHLAAMDDLDMKQFSHLVGFECDGVSLDAVLKMRMLLQLRRTENKVQL
RHLQFEFRRNNENALLDVLQDHAETLVCVNLFFSCSPGIDTREWCRAFEN
MHNLRTLKLSGNCHLVLLEAVLRAVPESAPIRQLDLTGMLSLTNELLLYV
AGKWQSTLKVLDLMFCVQLNANCIDALRQLSGRLEALTMAYCRELTGTGL
LQGLAGDINYSLQELHLEETIFLDESSMCQLLERLPNLRRLSLDNCRQAV
TDRTMATICQYQTRLRNLNIEYCMKITDQGLMGYGDTPYPISRLRGLKEL
NLRGCRNVTDSSLMVGLKLPELRALSLGYCNRLTSEGFEALTQNCPSLEA
LCVSSCMAVDDETVLNIVSNLKRLRVLNLSNCTKLTLQSIHHILAHGHNL
VQLIACSIDGMDHEQAQRILESQRPQMKQVLL*

MIP13919.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG12402-PC 671 CG12402-PC 1..632 1..632 3270 100 Plus
CG12402-PB 639 CG12402-PB 1..632 1..632 3270 100 Plus
CG12402-PA 632 CG12402-PA 1..632 1..632 3270 100 Plus
CG8272-PA 689 CG8272-PA 14..635 78..596 253 22.3 Plus
CG8272-PB 710 CG8272-PB 14..635 78..596 253 22.3 Plus
CG8272-PA 689 CG8272-PA 294..675 187..585 165 21.9 Plus