Clone MIP14095 Report

Search the DGRC for MIP14095

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:140
Well:95
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptNimA-RD
Protein status:MIP14095.pep: gold
Sequenced Size:2895

Clone Sequence Records

MIP14095.complete Sequence

2895 bp assembled on 2009-11-04

GenBank Submission: BT100252.1

> MIP14095.complete
CGATCCAGACGTACACGCAGCGCACATCAAACGGTTTAAATTGATGGATG
TAAGCGGATAAGATCCTCGTTTGGACCAGAACTAGATCAGAATATTAAAT
ATTGTAGGAATGTGTTATGCGAATTAATAGTTCAAGGTCCTAAAAATAAT
AAACGGAGATGGGCAAAAGTGATTAAGGTTTTCGGGGTATCAAAAGAATT
TTCATCAATTAAAAAAAATTTGCGATCAGTAATCATTGATGGATATGGTA
AACGAGGAATAAAGTGAATGCCTTTCAGCTGTAAAAAGAAGTGAAATATA
AAACAACAAATATGATAAGAGAAAAGCTATTCGGAAAACTGCTCCTCCTG
CTTGCAATGGTTTTACCATTGGGATCAGGACAAAACAGCACCCTCAAGAT
CAACACAAACGTGAAAGATATTGAAGCTGGGGTTGTGGCTCTGCCCTCCA
TCCAGGGACCCGGGAACATCTGCATACGCGAGGAGCCATATGTGGAGCAC
GTCCAGGTGCCAGAGATGCAGCCGGTGCGTGTGCGGACCTCCAGTTGGTG
CATGGAGATCCCGCCGAGATGCGCCACCTTCAAGACGGAAATGCGCGAGG
TGATGAGGGTCCAGAAATTGAACAAAACGCGAACAGTTCGCTTCTGCTGT
CAAGGATACGAGGGAAATTTGTCGGATAGTCAAGCCACATGCAAGCCCAT
TTGCAGGGGCGGCTGTGGGCGTGGCAGTTGCGTAATGCCTGACATTTGCA
GCTGCGAAGAGGGCTATATTGGCAAACATTGCACACAGCGCTGTGATCAC
GATCGCTGGGGACTGGACTGCAAGAATCTATGCCAATGTCAAAATGGAGC
AGCCTGCGACAATAAATCGGGACTTTGTCACTGCATTGCCGGTTGGACAG
GACAATTTTGCGAGCTGCCCTGTCCACAGGGAACTTACGGCATCATGTGC
CGCAAGGCTTGCGACTGCGATGAGAAGCCTTGCAATCCACAAACGGGTGC
TTGCATCCAGCAGGATCAACCTCTCCAACTGAATGTGAGCCACGTCATCG
TGGAGACTGTGAACTCCACGCTGGAGAAAATGGGTATTATACCGCGTCCC
ACCACGCCCGTTCCCCTGCCGGAGGTCATAGTAATTAAGCAACCGACCAG
CAATGAAAATGCCCAACACTCACCAAAGATCATTGTCCACCAATCGAGCA
GTGACCTACTCGAGAATCTCCATACGGCTGCAGCCGCCGGTGTTCCCACT
CCGGAGGTCATACACGTCATCACCAATGGGATCACCTCGCCACAGGAGCA
TTTGGCCGGATTCGTTGGAGGTGAGGCCAATTCAAGTCAGACGGCGACAG
CTGATCATCAGTCCGGCTTGGTGGTCACACTGGTCAGCATAATGCTCCTC
CTGCTGGTCGCCATTGCGGTGGGTTCACTGTATGTGTACCGGAGGTATCA
CCACAAAAATGCCGCAGTATACAATGCCAACGGAACGGTGACCACGCTGC
CTGCAAATCCGGAAGTGGTTCTCACCGAAGCCGCGGTCCTGGGAAAAAAC
TTCCACGAACCACTGCCTGAACCGCCCGTGGCCTTTGCGGTCACGCCCCA
ATCAAACGAGGGTATCACAACCAGAGCTATATGATAGTCCCAGCAACAAC
TCCTCAATTAAAACCCCACCTTACGCCTATGCCAGGAAGGAGTCACTCTA
CTCGGTGGTTTCGCCCAAGTCTCGAAAGGGAAGCCTGGACTCGCATCTGT
ACGACGAGATTCGCTACCACCAACAGCACCACCATCAGCAGCACCACCCA
CGGAGCCATCAGCATGTTCAGCACTCCACAACCGCCTCTCAGTTTTTGCC
GGCGAGGCCACAGATCATGCCCGCGAACGACCAGTTCTCCAATGGAAGTG
TTCATCCGCATCAGCGGTCGCATCATGTCACCCACTTGATAATTCCGCCA
CAGAACTCAAACTTCTTGCAGGTTCCTGCCCAAATCACAGCCAAAAGAGT
TGCCCACCTGTAAACTTTATTGCTGACACAAAGGATTTTTCTGAACATAT
GAAAATTCGTTAGACCTTTGGTAACTTTTACATATTGTACAAATCTATTT
CAATTTAAACTTGAAATGTGCCCTTCTAACATATACCAGGTAATTTTATA
TCATATTTATCCAATAATTTGTCCCAAAACTCACATTTAAAGTCTGCGAG
TTTTTACAACCACACTTATTTTTATAACATACTTTAGATCAGTAATAAAT
TTATGTACAGAAGCCAAATGTTAAGTGAGCATACATTTTGATTACATCAT
TATTTTAAGCTGCCCACGAATTATTATAACATTATATTATGGAAGATATG
ATATGAACTGGGAAAAATAACATTAATTAAACATAAAAAAAAAAATTAAT
TCATAAATCATATAAGAATTGGATTGGCGATTATCAAACTAATAGAGTTT
CACCTAATTTCTATTACTTTTTAAAGGTGATTTGCATGGTTAAAGGTTTC
TGCATTATTTAAGGGTAGTCTTTGATTAGATTTAACACTTTTATATCCAT
AAAAACCTATGTGTTAGACTTTAAGTTTCTTTAAAGTCTACGATTGTGGC
GTGTGTAGTTTCCGCATAGTTGTAACGTTTTAAATTTTTAAAAGTATGTT
TGCTGTAGCAACAGTTTTAAAAATAAAAAATGTTATGACTTCAAAAAATA
TATAAAACTAATTATATTTATAGTTAAAAATAAAAAACAGCTATAATAAC
ATTACTATATTATAAAACATATTATATTTATGCAAAAGCTGATTCATAAA
ATAATTATTAGAATAAAGCCATGTAGCCACATTTTGTAAGTTAAAGACTA
TTATTTAATAAAATCGTCTAATAAAACAAAAAAAAAAAAAAAAAA

MIP14095.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:42:01
Subject Length Description Subject Range Query Range Score Percent Strand
nimA.d 2733 nimA.d 38..2733 1..2696 13480 100 Plus
nimA-RC 2732 nimA-RC 41..2732 1..2696 13395 99.8 Plus
nimA.b 2514 nimA.b 38..2514 1..2477 12385 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 07:48:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13960871..13962132 1616..2877 6100 98.9 Plus
chr2L 23010047 chr2L 13960000..13960707 908..1615 3435 99 Plus
chr2L 23010047 chr2L 13956293..13956906 1..614 3070 100 Plus
chr2L 23010047 chr2L 13959583..13959761 612..790 865 98.9 Plus
chr2L 23010047 chr2L 13959814..13959931 790..907 590 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 07:48:15
Subject Length Description Subject Range Query Range Score Percent Strand
NimA-RE 1698 CG42282-PE 1..1698 312..2013 8415 99.8 Plus
NimA-RF 1698 CG42282-PF 1..1698 312..2013 8415 99.8 Plus
NimA-RD 1323 CG42282-PD 1..1323 312..1634 6615 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:06 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 07:48:14
Subject Length Description Subject Range Query Range Score Percent Strand
NimA-RD 2877 CG42282-RD 1..2877 1..2877 14385 100 Plus
NimA-RE 2873 CG42282-RE 1..2873 1..2877 14290 99.9 Plus
NimA-RF 2185 CG42282-RF 1..2185 247..2435 10850 99.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 07:48:19
Subject Length Description Subject Range Query Range Score Percent Strand
NimA-PD 440 CG42282-PD 1..440 312..1631 2281 100 Plus
NimA-PE 565 CG42282-PE 1..433 312..1610 2248 100 Plus
NimA-PF 565 CG42282-PF 1..433 312..1610 2248 100 Plus
NimA-PE 565 CG42282-PE 430..565 1603..2010 574 97.1 Plus
NimA-PF 565 CG42282-PF 430..565 1603..2010 574 97.1 Plus
drpr-PD 613 CG2086-PD 20..224 441..1043 388 36.7 Plus
drpr-PF 976 CG2086-PF 20..247 441..1007 372 31.8 Plus
drpr-PD 613 CG2086-PD 254..327 747..968 181 36.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 07:48:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13962120..13963383 1616..2879 6320 100 Plus
2L 23513712 2L 13961249..13961956 908..1615 3540 100 Plus
2L 23513712 2L 13957539..13958152 1..614 3070 100 Plus
2L 23513712 2L 13960828..13961006 612..790 895 100 Plus
2L 23513712 2L 13961064..13961181 790..907 590 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13962120..13963383 1616..2879 6320 100 Plus
2L 23513712 2L 13961249..13961956 908..1615 3540 100 Plus
2L 23513712 2L 13957539..13958152 1..614 3070 100 Plus
2L 23513712 2L 13960828..13961006 612..790 895 100 Plus
2L 23513712 2L 13961064..13961181 790..907 590 100 Plus
Blast to na_te.dros performed 2014-11-27 07:48:12
Subject Length Description Subject Range Query Range Score Percent Strand
TAHRE 10463 TAHRE OSV 10463bp 24..92 2793..2864 127 68.1 Plus
McClintock 6450 McClintock McCLINTOCK 6450bp 3642..3702 2174..2231 126 72.1 Plus
gypsy5 7369 gypsy5 GYPSY5 7369bp 1803..1876 2705..2629 116 64.9 Minus

MIP14095.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 09:51:07 Download gff for MIP14095.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13960871..13962132 1616..2877 98   Plus
chr2L 13960000..13960707 908..1615 99 -> Plus
chr2L 13959814..13959931 790..907 100 -> Plus
chr2L 13959586..13959760 615..789 98 -> Plus
chr2L 13956293..13956906 1..614 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-11-04 10:04:02 Download gff for MIP14095.complete
Subject Subject Range Query Range Percent Splice Strand
nimA-RC 1..1653 357..2013 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:17:24 Download gff for MIP14095.complete
Subject Subject Range Query Range Percent Splice Strand
nimA-RE 1..1698 312..2013 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:03:34 Download gff for MIP14095.complete
Subject Subject Range Query Range Percent Splice Strand
NimA-RF 1..1698 312..2013 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:51:07 Download gff for MIP14095.complete
Subject Subject Range Query Range Percent Splice Strand
NimA-RF 1..1698 312..2013 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-11-04 10:04:01 Download gff for MIP14095.complete
Subject Subject Range Query Range Percent Splice Strand
nimA-RC 1..2117 357..2477 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:17:24 Download gff for MIP14095.complete
Subject Subject Range Query Range Percent Splice Strand
nimA-RD 1..2877 1..2877 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:03:34 Download gff for MIP14095.complete
Subject Subject Range Query Range Percent Splice Strand
NimA-RD 1..2877 1..2877 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:51:07 Download gff for MIP14095.complete
Subject Subject Range Query Range Percent Splice Strand
NimA-RD 1..2877 1..2877 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 09:51:07 Download gff for MIP14095.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13962120..13963381 1616..2877 100   Plus
2L 13961249..13961956 908..1615 100 -> Plus
2L 13961064..13961181 790..907 100 -> Plus
2L 13960831..13961005 615..789 100 -> Plus
2L 13957539..13958152 1..614 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:03:34 Download gff for MIP14095.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13962120..13963381 1616..2877 100   Plus
arm_2L 13961249..13961956 908..1615 100 -> Plus
arm_2L 13961064..13961181 790..907 100 -> Plus
arm_2L 13960831..13961005 615..789 100 -> Plus
arm_2L 13957539..13958152 1..614 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:06:54 Download gff for MIP14095.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13962120..13963381 1616..2877 100   Plus
2L 13961249..13961956 908..1615 100 -> Plus
2L 13961064..13961181 790..907 100 -> Plus
2L 13960831..13961005 615..789 100 -> Plus
2L 13957539..13958152 1..614 100 -> Plus

MIP14095.pep Sequence

Translation from 311 to 1633

> MIP14095.pep
MIREKLFGKLLLLLAMVLPLGSGQNSTLKINTNVKDIEAGVVALPSIQGP
GNICIREEPYVEHVQVPEMQPVRVRTSSWCMEIPPRCATFKTEMREVMRV
QKLNKTRTVRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEE
GYIGKHCTQRCDHDRWGLDCKNLCQCQNGAACDNKSGLCHCIAGWTGQFC
ELPCPQGTYGIMCRKACDCDEKPCNPQTGACIQQDQPLQLNVSHVIVETV
NSTLEKMGIIPRPTTPVPLPEVIVIKQPTSNENAQHSPKIIVHQSSSDLL
ENLHTAAAAGVPTPEVIHVITNGITSPQEHLAGFVGGEANSSQTATADHQ
SGLVVTLVSIMLLLLVAIAVGSLYVYRRYHHKNAAVYNANGTVTTLPANP
EVVLTEAAVLGKNFHEPLPEPPVAFAVTPQSNEGITTRAI*

MIP14095.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 11:04:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14272-PA 566 GF14272-PA 1..433 1..434 1906 78.8 Plus
Dana\GF24969-PA 137 GF24969-PA 20..128 44..157 216 41.2 Plus
Dana\GF24971-PA 902 GF24971-PA 18..105 146..232 180 39.8 Plus
Dana\GF24971-PA 902 GF24971-PA 410..481 146..217 165 44.4 Plus
Dana\GF24971-PA 902 GF24971-PA 364..454 145..232 165 40.7 Plus
Dana\GF24971-PA 902 GF24971-PA 322..415 146..235 161 39.4 Plus
Dana\GF24971-PA 902 GF24971-PA 236..340 146..241 154 39 Plus
Dana\GF24971-PA 902 GF24971-PA 147..236 146..231 153 38.9 Plus
Dana\GF24971-PA 902 GF24971-PA 61..147 146..231 153 40.2 Plus
Dana\GF24971-PA 902 GF24971-PA 278..366 145..232 152 40.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 11:04:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23901-PA 425 GG23901-PA 1..293 142..434 1490 93.5 Plus
Dere\GG23899-PA 105 GG23899-PA 1..101 1..101 443 94.1 Plus
Dere\GG14568-PA 136 GG14568-PA 21..129 44..157 210 40.4 Plus
Dere\GG14570-PA 899 GG14570-PA 18..105 146..232 179 39.8 Plus
Dere\GG14570-PA 899 GG14570-PA 278..366 145..232 167 41.6 Plus
Dere\GG14570-PA 899 GG14570-PA 322..415 146..235 160 38.3 Plus
Dere\GG14570-PA 899 GG14570-PA 236..340 146..241 160 39 Plus
Dere\GG14570-PA 899 GG14570-PA 410..481 146..217 157 41.7 Plus
Dere\GG14570-PA 899 GG14570-PA 365..454 146..232 156 38.9 Plus
Dere\GG14570-PA 899 GG14570-PA 61..147 146..231 155 40.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 11:04:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11128-PA 471 GH11128-PA 1..310 142..434 860 55.8 Plus
Dgri\GH15511-PA 1050 GH15511-PA 22..251 41..231 326 33.2 Plus
Dgri\GH17254-PA 102 GH17254-PA 10..88 23..101 270 74.7 Plus
Dgri\GH15511-PA 1050 GH15511-PA 189..294 127..231 184 42.1 Plus
Dgri\GH15511-PA 1050 GH15511-PA 511..600 146..232 174 42.2 Plus
Dgri\GH15511-PA 1050 GH15511-PA 382..469 146..232 167 42 Plus
Dgri\GH15511-PA 1050 GH15511-PA 556..627 146..217 165 41.7 Plus
Dgri\GH15511-PA 1050 GH15511-PA 468..557 146..232 153 36.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:04:30
Subject Length Description Subject Range Query Range Score Percent Strand
NimA-PD 440 CG42282-PD 1..440 1..440 2365 100 Plus
NimA-PE 565 CG42282-PE 1..433 1..433 2332 100 Plus
NimA-PF 565 CG42282-PF 1..433 1..433 2332 100 Plus
drpr-PD 613 CG2086-PD 20..224 44..244 388 36.7 Plus
drpr-PF 976 CG2086-PF 20..247 44..232 372 31.8 Plus
drpr-PD 613 CG2086-PD 254..327 146..219 181 36.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 11:04:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12658-PA 619 GI12658-PA 32..444 24..415 1370 62.8 Plus
Dmoj\GI16787-PA 1045 GI16787-PA 30..252 48..231 318 35.5 Plus
Dmoj\GI16787-PA 1045 GI16787-PA 511..601 145..232 189 44 Plus
Dmoj\GI16787-PA 1045 GI16787-PA 209..295 146..231 182 42.5 Plus
Dmoj\GI16787-PA 1045 GI16787-PA 557..628 146..217 170 41.7 Plus
Dmoj\GI16787-PA 1045 GI16787-PA 383..487 146..241 167 38.1 Plus
Dmoj\GI16787-PA 1045 GI16787-PA 425..513 145..232 167 40.4 Plus
Dmoj\GI16787-PA 1045 GI16787-PA 469..558 146..232 162 40 Plus
Dmoj\GI16787-PA 1045 GI16787-PA 647..732 148..232 156 39.5 Plus
Dmoj\GI16787-PA 1045 GI16787-PA 688..761 146..219 156 40.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 11:04:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21251-PA 430 GL21251-PA 1..298 142..434 1234 80.6 Plus
Dper\GL20463-PA 158 GL20463-PA 21..101 21..101 381 85.2 Plus
Dper\GL11918-PA 739 GL11918-PA 22..236 44..232 328 34.5 Plus
Dper\GL11877-PA 627 GL11877-PA 22..120 44..147 189 39.4 Plus
Dper\GL11918-PA 739 GL11918-PA 367..471 146..241 183 41 Plus
Dper\GL11918-PA 739 GL11918-PA 437..524 132..217 172 39.8 Plus
Dper\GL11918-PA 739 GL11918-PA 278..367 146..231 168 41.1 Plus
Dper\GL11918-PA 739 GL11918-PA 409..497 145..232 163 41.6 Plus
Dper\GL11918-PA 739 GL11918-PA 192..278 146..231 161 41.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 11:04:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28782-PA 571 GA28782-PA 21..439 21..434 1853 83.6 Plus
Dpse\GA23961-PA 146 GA23961-PA 22..130 44..157 215 40.4 Plus
Dpse\GA23962-PA 880 GA23962-PA 306..415 132..235 185 39.1 Plus
Dpse\GA23962-PA 880 GA23962-PA 18..105 146..232 179 40.9 Plus
Dpse\GA23962-PA 880 GA23962-PA 236..340 146..241 175 41 Plus
Dpse\GA23962-PA 880 GA23962-PA 147..236 146..231 162 41.1 Plus
Dpse\GA23962-PA 880 GA23962-PA 278..366 145..232 162 41.6 Plus
Dpse\GA23962-PA 880 GA23962-PA 61..147 146..231 155 41.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 11:04:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15408-PA 421 GM15408-PA 1..290 142..434 1507 95.6 Plus
Dsec\GM15396-PA 104 GM15396-PA 1..101 1..101 460 96 Plus
Dsec\GM14177-PA 135 GM14177-PA 20..128 44..157 210 39.5 Plus
Dsec\GM14179-PA 900 GM14179-PA 18..105 146..232 176 39.8 Plus
Dsec\GM14179-PA 900 GM14179-PA 278..366 145..232 167 41.6 Plus
Dsec\GM14179-PA 900 GM14179-PA 365..454 146..232 165 41.1 Plus
Dsec\GM14179-PA 900 GM14179-PA 322..415 146..235 162 39.4 Plus
Dsec\GM14179-PA 900 GM14179-PA 236..340 146..241 159 39 Plus
Dsec\GM14179-PA 900 GM14179-PA 147..236 146..231 157 40 Plus
Dsec\GM14179-PA 900 GM14179-PA 61..147 146..231 154 40.2 Plus
Dsec\GM14179-PA 900 GM14179-PA 410..481 146..217 154 41.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 11:04:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23941-PA 421 GD23941-PA 1..290 142..434 1504 95.2 Plus
Dsim\GD23940-PA 104 GD23940-PA 1..101 1..101 460 96 Plus
Dsim\GD13445-PA 135 GD13445-PA 20..128 44..157 210 39.5 Plus
Dsim\GD13447-PA 938 GD13447-PA 18..105 146..232 171 39.8 Plus
Dsim\GD13447-PA 938 GD13447-PA 278..366 145..232 161 41.6 Plus
Dsim\GD13447-PA 938 GD13447-PA 322..415 146..235 156 39.4 Plus
Dsim\GD13447-PA 938 GD13447-PA 236..340 146..241 154 39 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 11:04:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18159-PA 616 GJ18159-PA 29..485 22..438 1467 61.5 Plus
Dvir\GJ12529-PA 1051 GJ12529-PA 33..255 48..231 310 33.8 Plus
Dvir\GJ12529-PA 1051 GJ12529-PA 212..298 146..231 178 41.4 Plus
Dvir\GJ12529-PA 1051 GJ12529-PA 560..631 146..217 166 41.7 Plus
Dvir\GJ12529-PA 1051 GJ12529-PA 386..490 146..241 155 39 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 11:04:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15022-PA 420 GK15022-PA 1..304 142..437 1040 68 Plus
Dwil\GK17063-PA 658 GK17063-PA 16..131 37..157 251 39.8 Plus
Dwil\GK17064-PA 892 GK17064-PA 18..105 146..232 187 42 Plus
Dwil\GK17064-PA 892 GK17064-PA 61..146 146..231 167 41.9 Plus
Dwil\GK17064-PA 892 GK17064-PA 309..411 135..232 160 35.9 Plus
Dwil\GK17064-PA 892 GK17064-PA 278..366 145..232 159 40.4 Plus
Dwil\GK17064-PA 892 GK17064-PA 146..236 146..232 158 39.6 Plus
Dwil\GK17064-PA 892 GK17064-PA 364..462 145..217 152 34.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 11:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19014-PA 428 GE19014-PA 1..293 142..434 1515 95.2 Plus
Dyak\GE19013-PA 105 GE19013-PA 1..101 1..101 456 97 Plus
Dyak\GE20922-PA 135 GE20922-PA 20..128 44..157 210 39.5 Plus
Dyak\GE20925-PA 900 GE20925-PA 18..105 146..232 177 39.8 Plus
Dyak\GE20925-PA 900 GE20925-PA 322..415 146..235 168 40.4 Plus
Dyak\GE20925-PA 900 GE20925-PA 278..366 145..232 167 41.6 Plus
Dyak\GE20925-PA 900 GE20925-PA 365..454 146..232 163 40 Plus
Dyak\GE20925-PA 900 GE20925-PA 231..340 143..241 160 39.1 Plus
Dyak\GE20925-PA 900 GE20925-PA 61..147 146..231 157 40.2 Plus
Dyak\GE20925-PA 900 GE20925-PA 410..481 146..217 156 41.7 Plus
Dyak\GE20925-PA 900 GE20925-PA 147..236 146..231 152 40 Plus

MIP14095.hyp Sequence

Translation from 311 to 1633

> MIP14095.hyp
MIREKLFGKLLLLLAMVLPLGSGQNSTLKINTNVKDIEAGVVALPSIQGP
GNICIREEPYVEHVQVPEMQPVRVRTSSWCMEIPPRCATFKTEMREVMRV
QKLNKTRTVRFCCQGYEGNLSDSQATCKPICRGGCGRGSCVMPDICSCEE
GYIGKHCTQRCDHDRWGLDCKNLCQCQNGAACDNKSGLCHCIAGWTGQFC
ELPCPQGTYGIMCRKACDCDEKPCNPQTGACIQQDQPLQLNVSHVIVETV
NSTLEKMGIIPRPTTPVPLPEVIVIKQPTSNENAQHSPKIIVHQSSSDLL
ENLHTAAAAGVPTPEVIHVITNGITSPQEHLAGFVGGEANSSQTATADHQ
SGLVVTLVSIMLLLLVAIAVGSLYVYRRYHHKNAAVYNANGTVTTLPANP
EVVLTEAAVLGKNFHEPLPEPPVAFAVTPQSNEGITTRAI*

MIP14095.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:01:58
Subject Length Description Subject Range Query Range Score Percent Strand
NimA-PD 440 CG42282-PD 1..440 1..440 2365 100 Plus
NimA-PE 565 CG42282-PE 1..433 1..433 2332 100 Plus
NimA-PF 565 CG42282-PF 1..433 1..433 2332 100 Plus
drpr-PD 613 CG2086-PD 20..224 44..244 388 36.7 Plus
drpr-PF 976 CG2086-PF 20..247 44..232 372 31.8 Plus
drpr-PD 613 CG2086-PD 254..327 146..219 181 36.5 Plus