Clone MIP14128 Report

Search the DGRC for MIP14128

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:141
Well:28
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG34248-RB
Protein status:MIP14128.pep: gold
Sequenced Size:486

Clone Sequence Records

MIP14128.complete Sequence

486 bp assembled on 2009-09-28

GenBank Submission: BT099872.1

> MIP14128.complete
AGAACGTTGAGCTATCAGATCTTATCAGCTCGGATTAGCTATGTACAGGA
AATTAGTGGTGCTCCTCCTTCTGATCCACCTGGCGGCCGCGGGTCAGATC
CAGGATGCTGCCGAGGAGATCGATGTGCCGCCTGCCCATCGGGCTGCTCC
ACCACCGCCCCGCCAGGCAGCTGGAGCTGCTGTTCCCCCACCACCACTGG
GGCCACCACCACTTGTGGGCTCTGCACCGCCGCCGAGCTATCCTTTGTTC
TACCCAGCTGCGTGGCTGCCATTCGGACGCTACAGCAACTCCATTCCCGT
CCACATAGTGGCTGCCTAGGGGAGCGTCCTCCCACTGGCCATAAGGTGGT
CAAAGGACACTGTTGTCCCTCCTGTTGAATCCTTTCCCTGTTATGGTTGC
TATTTTACTCGTTATTGCCCGCTTTAAGCCAGAAATATATTTTTAGACAC
GCAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

MIP14128.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG34248.a 608 CG34248.a 109..561 1..453 2265 100 Plus
CG34248-RA 429 CG34248-RA 34..429 56..451 1980 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16260069..16260465 452..56 1985 100 Minus
chr3L 24539361 chr3L 16260546..16260602 57..1 285 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG34248-RB 279 CG34248-PB 1..279 41..319 1395 100 Plus
CG34248-RA 297 CG34248-PA 34..297 56..319 1320 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:12 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:03:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG34248-RB 452 CG34248-RB 1..452 1..452 2260 100 Plus
CG34248-RA 533 CG34248-RA 138..533 56..451 1980 100 Plus
CG34248-RA 533 CG34248-RA 1..57 1..57 285 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:03:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG34248-PB 92 CG34248-PB 1..92 41..316 193 100 Plus
CG34248-PA 98 CG34248-PA 18..98 74..316 178 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:03:35
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16270368..16270765 453..56 1990 100 Minus
3L 28110227 3L 16270846..16270902 57..1 285 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16263468..16263865 453..56 1990 100 Minus
3L 28103327 3L 16263946..16264002 57..1 285 100 Minus
Blast to na_te.dros performed on 2014-11-27 05:03:36 has no hits.

MIP14128.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:27:19 Download gff for MIP14128.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16260548..16260602 1..55 100   Minus
chr3L 16260069..16260465 56..452 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:45 Download gff for MIP14128.complete
Subject Subject Range Query Range Percent Splice Strand
CG34248-RA 34..297 56..319 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:43 Download gff for MIP14128.complete
Subject Subject Range Query Range Percent Splice Strand
CG34248-RB 1..279 41..319 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:35:11 Download gff for MIP14128.complete
Subject Subject Range Query Range Percent Splice Strand
CG34248-RB 1..279 41..319 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:27:19 Download gff for MIP14128.complete
Subject Subject Range Query Range Percent Splice Strand
CG34248-RB 1..279 41..319 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 11:23:16 Download gff for MIP14128.complete
Subject Subject Range Query Range Percent Splice Strand
CG34248-RA 34..429 56..451 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:42 Download gff for MIP14128.complete
Subject Subject Range Query Range Percent Splice Strand
CG34248-RB 1..452 1..452 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:35:11 Download gff for MIP14128.complete
Subject Subject Range Query Range Percent Splice Strand
CG34248-RB 1..452 1..452 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:27:19 Download gff for MIP14128.complete
Subject Subject Range Query Range Percent Splice Strand
CG34248-RB 1..452 1..452 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:27:19 Download gff for MIP14128.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16270848..16270902 1..55 100   Minus
3L 16270369..16270765 56..452 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:35:11 Download gff for MIP14128.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16263948..16264002 1..55 100   Minus
arm_3L 16263469..16263865 56..452 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:32 Download gff for MIP14128.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16263948..16264002 1..55 100   Minus
3L 16263469..16263865 56..452 100 <- Minus

MIP14128.hyp Sequence

Translation from 0 to 377

> MIP14128.hyp
RTLSYQILSARISYVQEISGAPPSDPPGGRGSDPGCCRGDRCAACPSGCS
TTAPPGSWSCCSPTTTGATTTCGLCTAAELSFVLPSCVAAIRTLQQLHSR
PHSGCLGERPPTGHKVVKGHCCPSC*
Sequence MIP14128.hyp has no blast hits.

MIP14128.pep Sequence

Translation from 40 to 318

> MIP14128.pep
MYRKLVVLLLLIHLAAAGQIQDAAEEIDVPPAHRAAPPPPRQAAGAAVPP
PPLGPPPLVGSAPPPSYPLFYPAAWLPFGRYSNSIPVHIVAA*

MIP14128.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10306-PA 91 GF10306-PA 1..89 1..92 213 71.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13480-PA 98 GG13480-PA 12..98 6..92 252 89.7 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG34248-PB 92 CG34248-PB 1..92 1..92 490 100 Plus
CG34248-PA 98 CG34248-PA 12..98 6..92 464 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:01:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24429-PA 98 GM24429-PA 24..98 18..92 198 97.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12498-PA 98 GD12498-PA 24..98 18..92 202 97.3 Plus