Clone MIP14345 Report

Search the DGRC for MIP14345

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:143
Well:45
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG3649-RB
Protein status:MIP14345.pep: gold
Sequenced Size:1564

Clone Sequence Records

MIP14345.complete Sequence

1564 bp assembled on 2009-09-28

GenBank Submission: BT099898.1

> MIP14345.complete
GTCGTTGCGCCGCTCAATGACGATAAAATCGTTCAACTTGGTGGTAAAGG
GTCCCATGTGGGGCGTTCGCCACCTGCAGGTACTGTTCCTCTTTCTGTGC
GCCACCTTGATCGTGGCCCAGAGGTTCAACATGAGCGTGGCCATTGTGGC
CTTTACGAATGCCAATAGCAGCAACCCAAATTATCCGGAATACCGACTGA
CAGAGCCTCAGAAGTCGTACACCATCAGCAGTCCCTTCTGGGGCTCCTGC
TGCACCCAGATGATGAGTGGATACCTATCGAGTCGCTTTGGAGCCAAGGT
GCTGCTGCTGACCATCATGTTGCTCACCGCTCTGCTCAGCATTGCCACGC
CCTTCGCCTTGGCCTGGGGCGGCTGGCAGCTGCTCTTCTGGGTGCGATTC
GTCCAGGGACTCGCCATGGGCGGCATGTGGCCCTGCCTGTACACCCATCT
GGCCAAGTGGTGTCCCAAGAAGGAGGCCAATCGCATGGGCGGCATCATGA
CCACTGGCTTGGATTGTGGGACAATAATGGGATTCGCTTTGAGTGGCGTA
CTCTCTGCATCGCCCCTCGGGTGGCCCAGCACATTCTACGTGCCAGGATA
CTTAGGCATCGTGTGGTGCCTTACTTTCTTGCGATATGGCGCCAACAGCC
CATCCGAATCGAAATTCATTTCTCTGGCGGAACGAAAGCACATTCAATTT
GCCCTCGAGCAGAATCAGGTGATTCGCGGTGCAACTCCTCCAGTACCGTG
GCTCCAGATCCTCACCTCTCGTCCATTTATCGTCCTGGCGTTTTGCAAAA
TGAGCCAGGCGTGCAGCTTCTACACGCTGATGCAACAGATTCCGCGCTAC
ATCCACGGTATATTCCACTACAGCATTGCGGCAAATGCCCTGCTCTCAGC
TCTGCCCTTTGTGGTCATGCTGATGTCATCCTACGGATTCATTTTCCTGG
CTGAATACCTAACCCGTCGTCGAGACATTTCATTGCCTATCCTACGGAAG
ACCATTAATTCCTTTGCCACATGGACCCCTGCTGTAGCCCTGGTTATCCT
ATCCTACGTCAGCGATCAGAATGTGGTGGGCAGTATGTTTTGTCTGATTG
CAGCCACAGCTGCCATTTCCGGACAGGCCATTGGCAGTTCCCTTAACCAC
GTGGACTTGTCGCCAAACTTTGCTGGACTCCTGTTTGGGATGAGCAACAC
ACTGATGTCTGCGGCTGGTGTGATATCGCCAATCGTCATTGGGCTGACCG
TAACCAAAGAGTCGGATCGATCGCAATGGCGAACAGTTTTCCTTGGCATT
TCGGTGATTCTGTTCCTCGGCAACTTGATGTACCTAATCTTTGGTCAAAT
GACCGTCCAGTCCTGGAATGATTCCCCATCCAAAGAGACCGAAACAGAAG
CATCACCAAAGCCCCAGGCATCGGCTCCCTCAGTTGCCGAGGAAACGATA
TCCGTCGAGAGATTTAACTATTTGTAAATGTATATTTGTAATAACGTAAT
CAGTGCTAATGTTGTTGTATAAAAACAGTTTAAAATCACAATGGTAAAAA
AAAAAAAAAAAAAA

MIP14345.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG3649-RA 1422 CG3649-RA 1..1422 56..1477 7110 100 Plus
CG13531-RB 5830 CG13531-RB 5643..5830 1546..1359 940 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-26 19:38:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18733486..18734153 594..1261 3325 99.9 Plus
chr2R 21145070 chr2R 18732688..18733235 50..597 2740 100 Plus
chr2R 21145070 chr2R 18734202..18734487 1260..1545 1430 100 Plus
chr2R 21145070 chr2R 18732577..18732628 1..52 260 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:38:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG3649-RB 1461 CG3649-PB 1..1461 17..1477 7305 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:51 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:38:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG3649-RB 1569 CG3649-RB 25..1569 1..1545 7725 100 Plus
CG13531-RC 5665 CG13531-RC 5586..5665 1545..1466 400 100 Minus
CG13531-RB 5566 CG13531-RB 5487..5566 1545..1466 400 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-26 19:38:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG3649-PB 486 CG3649-PB 1..486 17..1474 2441 100 Plus
CG9826-PC 495 CG9826-PC 7..472 47..1438 958 40.8 Plus
CG9826-PA 495 CG9826-PA 7..472 47..1438 958 40.8 Plus
CG9825-PA 485 CG9825-PA 7..481 47..1468 931 38.7 Plus
CG30272-PA 497 CG30272-PA 8..455 50..1378 919 39.2 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-26 19:38:34
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22846910..22847577 594..1261 3340 100 Plus
2R 25286936 2R 22846112..22846659 50..597 2740 100 Plus
2R 25286936 2R 22847626..22847912 1260..1546 1435 100 Plus
2R 25286936 2R 22846001..22846052 1..52 260 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22848109..22848776 594..1261 3340 100 Plus
2R 25260384 2R 22847311..22847858 50..597 2740 100 Plus
2R 25260384 2R 22848825..22849111 1260..1546 1435 100 Plus
2R 25260384 2R 22847200..22847251 1..52 260 100 Plus
Blast to na_te.dros performed on 2014-11-26 19:38:35 has no hits.

MIP14345.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-26 21:57:23 Download gff for MIP14345.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18734204..18734487 1262..1545 100   Plus
chr2R 18733489..18734153 597..1261 99 -> Plus
chr2R 18732689..18733234 51..596 100 -> Plus
chr2R 18732577..18732626 1..50 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:56:05 Download gff for MIP14345.complete
Subject Subject Range Query Range Percent Splice Strand
CG3649-RA 1..1422 56..1477 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:35:34 Download gff for MIP14345.complete
Subject Subject Range Query Range Percent Splice Strand
CG3649-RB 1..1461 17..1477 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:27:44 Download gff for MIP14345.complete
Subject Subject Range Query Range Percent Splice Strand
CG3649-RB 1..1461 17..1477 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:57:23 Download gff for MIP14345.complete
Subject Subject Range Query Range Percent Splice Strand
CG3649-RB 1..1461 17..1477 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 16:54:22 Download gff for MIP14345.complete
Subject Subject Range Query Range Percent Splice Strand
CG3649-RA 1..1422 56..1477 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:35:33 Download gff for MIP14345.complete
Subject Subject Range Query Range Percent Splice Strand
CG3649-RB 1..1545 1..1545 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:27:44 Download gff for MIP14345.complete
Subject Subject Range Query Range Percent Splice Strand
CG3649-RB 25..1569 1..1545 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:57:23 Download gff for MIP14345.complete
Subject Subject Range Query Range Percent Splice Strand
CG3649-RB 25..1569 1..1545 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-26 21:57:23 Download gff for MIP14345.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22847628..22847911 1262..1545 100   Plus
2R 22846913..22847577 597..1261 100 -> Plus
2R 22846113..22846658 51..596 100 -> Plus
2R 22846001..22846050 1..50 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:27:44 Download gff for MIP14345.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18735151..18735434 1262..1545 100   Plus
arm_2R 18734436..18735100 597..1261 100 -> Plus
arm_2R 18733636..18734181 51..596 100 -> Plus
arm_2R 18733524..18733573 1..50 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:19:06 Download gff for MIP14345.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22848845..22849128 1262..1545 100   Plus
2R 22848130..22848794 597..1261 100 -> Plus
2R 22847330..22847875 51..596 100 -> Plus
2R 22847218..22847267 1..50 100 -> Plus

MIP14345.hyp Sequence

Translation from 0 to 1476

> MIP14345.hyp
SLRRSMTIKSFNLVVKGPMWGVRHLQVLFLFLCATLIVAQRFNMSVAIVA
FTNANSSNPNYPEYRLTEPQKSYTISSPFWGSCCTQMMSGYLSSRFGAKV
LLLTIMLLTALLSIATPFALAWGGWQLLFWVRFVQGLAMGGMWPCLYTHL
AKWCPKKEANRMGGIMTTGLDCGTIMGFALSGVLSASPLGWPSTFYVPGY
LGIVWCLTFLRYGANSPSESKFISLAERKHIQFALEQNQVIRGATPPVPW
LQILTSRPFIVLAFCKMSQACSFYTLMQQIPRYIHGIFHYSIAANALLSA
LPFVVMLMSSYGFIFLAEYLTRRRDISLPILRKTINSFATWTPAVALVIL
SYVSDQNVVGSMFCLIAATAAISGQAIGSSLNHVDLSPNFAGLLFGMSNT
LMSAAGVISPIVIGLTVTKESDRSQWRTVFLGISVILFLGNLMYLIFGQM
TVQSWNDSPSKETETEASPKPQASAPSVAEETISVERFNYL*

MIP14345.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:26:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG3649-PB 486 CG3649-PB 1..486 6..491 2525 100 Plus
CG9826-PC 495 CG9826-PC 7..472 16..479 996 40.8 Plus
CG9826-PA 495 CG9826-PA 7..472 16..479 996 40.8 Plus
CG9825-PA 485 CG9825-PA 7..481 16..489 949 38.7 Plus
CG30272-PA 497 CG30272-PA 8..455 17..459 943 39.2 Plus

MIP14345.pep Sequence

Translation from 1 to 1476

> MIP14345.pep
SLRRSMTIKSFNLVVKGPMWGVRHLQVLFLFLCATLIVAQRFNMSVAIVA
FTNANSSNPNYPEYRLTEPQKSYTISSPFWGSCCTQMMSGYLSSRFGAKV
LLLTIMLLTALLSIATPFALAWGGWQLLFWVRFVQGLAMGGMWPCLYTHL
AKWCPKKEANRMGGIMTTGLDCGTIMGFALSGVLSASPLGWPSTFYVPGY
LGIVWCLTFLRYGANSPSESKFISLAERKHIQFALEQNQVIRGATPPVPW
LQILTSRPFIVLAFCKMSQACSFYTLMQQIPRYIHGIFHYSIAANALLSA
LPFVVMLMSSYGFIFLAEYLTRRRDISLPILRKTINSFATWTPAVALVIL
SYVSDQNVVGSMFCLIAATAAISGQAIGSSLNHVDLSPNFAGLLFGMSNT
LMSAAGVISPIVIGLTVTKESDRSQWRTVFLGISVILFLGNLMYLIFGQM
TVQSWNDSPSKETETEASPKPQASAPSVAEETISVERFNYL*

MIP14345.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:56:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13547-PA 480 GF13547-PA 1..480 6..491 2040 79.1 Plus
Dana\GF13546-PA 496 GF13546-PA 7..471 16..480 944 39.6 Plus
Dana\GF13543-PA 498 GF13543-PA 8..464 17..468 937 39.1 Plus
Dana\GF13751-PA 491 GF13751-PA 34..478 21..461 898 40.4 Plus
Dana\GF13545-PA 474 GF13545-PA 7..468 16..474 895 37 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:56:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22806-PA 486 GG22806-PA 1..486 6..491 2369 90.7 Plus
Dere\GG22805-PA 495 GG22805-PA 7..469 16..477 965 40.4 Plus
Dere\GG22799-PA 509 GG22799-PA 8..456 17..460 917 38.2 Plus
Dere\GG22802-PA 473 GG22802-PA 7..463 16..471 912 38.7 Plus
Dere\GG10844-PA 482 GG10844-PA 6..474 16..481 895 37.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:56:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19791-PA 480 GH19791-PA 8..471 17..481 940 37.5 Plus
Dgri\GH19793-PA 483 GH19793-PA 1..464 22..484 930 40.1 Plus
Dgri\GH19792-PA 477 GH19792-PA 10..448 18..456 856 37.6 Plus
Dgri\GH24720-PA 470 GH24720-PA 15..457 21..461 855 39.6 Plus
Dgri\GH19796-PA 487 GH19796-PA 25..487 21..481 850 38.5 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:56:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG3649-PB 486 CG3649-PB 1..486 6..491 2525 100 Plus
CG9826-PC 495 CG9826-PC 7..472 16..479 996 40.8 Plus
CG9826-PA 495 CG9826-PA 7..472 16..479 996 40.8 Plus
CG9825-PA 485 CG9825-PA 7..481 16..489 949 38.7 Plus
CG30272-PA 497 CG30272-PA 8..455 17..459 943 39.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:56:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20333-PA 496 GI20333-PA 8..473 15..482 954 41.2 Plus
Dmoj\GI20331-PA 481 GI20331-PA 1..474 19..487 926 36.7 Plus
Dmoj\GI20332-PA 477 GI20332-PA 5..458 14..473 905 38 Plus
Dmoj\GI20337-PA 484 GI20337-PA 20..468 20..464 865 39.4 Plus
Dmoj\GI20334-PA 493 GI20334-PA 38..480 21..461 840 39.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:56:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11389-PA 445 GL11389-PA 1..445 6..491 1641 65.6 Plus
Dper\GL11388-PA 494 GL11388-PA 3..491 12..491 955 38.4 Plus
Dper\GL11386-PA 488 GL11386-PA 8..484 17..486 915 36.7 Plus
Dper\GL10849-PA 510 GL10849-PA 37..497 7..461 884 40.4 Plus
Dper\GL17791-PA 483 GL17791-PA 13..451 18..456 864 38.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:56:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17586-PA 504 GA17586-PA 19..504 5..491 1864 71.5 Plus
Dpse\GA22061-PA 494 GA22061-PA 3..491 12..491 961 38.7 Plus
Dpse\GA15741-PA 487 GA15741-PA 8..484 17..486 918 36.7 Plus
Dpse\GA13487-PA 510 GA13487-PA 37..497 7..461 887 40.4 Plus
Dpse\GA24910-PA 481 GA24910-PA 10..449 17..456 871 38.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:56:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15962-PA 226 GM15962-PA 1..210 6..215 1072 94.3 Plus
Dsec\GM15959-PA 481 GM15959-PA 7..477 16..489 907 37.9 Plus
Dsec\GM16495-PA 482 GM16495-PA 6..482 16..486 900 37.3 Plus
Dsec\GM19872-PA 508 GM19872-PA 37..495 7..461 890 40.7 Plus
Dsec\GM15958-PA 492 GM15958-PA 7..447 16..456 878 37.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:56:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11715-PA 486 GD11715-PA 1..486 6..491 2385 94.7 Plus
Dsim\GD11714-PA 494 GD11714-PA 7..471 16..479 949 40.3 Plus
Dsim\GD11710-PA 497 GD11710-PA 8..464 17..468 934 38.9 Plus
Dsim\GD11713-PA 485 GD11713-PA 7..481 16..489 909 37.9 Plus
Dsim\GD10346-PA 482 GD10346-PA 6..459 16..466 899 38.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:56:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22058-PA 496 GJ22058-PA 1..490 8..488 975 40 Plus
Dvir\GJ22055-PA 492 GJ22055-PA 8..479 17..486 952 38 Plus
Dvir\GJ22056-PA 477 GJ22056-PA 5..476 14..484 918 38.1 Plus
Dvir\GJ18404-PA 481 GJ18404-PA 9..464 17..473 899 38.9 Plus
Dvir\GJ22063-PA 497 GJ22063-PA 21..482 17..471 853 37.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:56:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21466-PA 377 GK21466-PA 1..376 6..381 1369 68.6 Plus
Dwil\GK21460-PA 494 GK21460-PA 7..481 16..484 957 37.9 Plus
Dwil\GK21464-PA 482 GK21464-PA 7..473 16..487 933 38.3 Plus
Dwil\GK21465-PA 503 GK21465-PA 7..476 16..479 929 39.6 Plus
Dwil\GK20703-PA 493 GK20703-PA 16..482 12..470 910 39.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14239-PA 486 GE14239-PA 1..486 6..491 2317 88.9 Plus
Dyak\GE14238-PA 495 GE14238-PA 7..466 16..474 957 40 Plus
Dyak\GE14234-PA 509 GE14234-PA 8..501 17..489 927 36.6 Plus
Dyak\GE14236-PA 483 GE14236-PA 7..469 16..483 911 37.6 Plus
Dyak\GE14237-PA 473 GE14237-PA 7..471 16..477 910 38.5 Plus