Clone MIP14365 Report

Search the DGRC for MIP14365

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:143
Well:65
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptCG9662-RA
Protein status:MIP14365.pep: gold
Sequenced Size:846

Clone Sequence Records

MIP14365.complete Sequence

846 bp assembled on 2010-07-20

GenBank Submission: BT125066.1

> MIP14365.complete
AACAAACTCCGCCTACGCCGGCAAAATTCAGCGACACCGCCACGAAAATT
GAAAAATCCGTGATATATTTAAATTTATAGTTATTAAATTATTAGTTCAT
CATGATCGAGACACTGTATAACCTGCCCTTCCACATCCTGGTGCCGCCGA
ACATCAAGGTGCGCAGATTCAGCATTCCAATGCCGTCACCGATGGCCGTT
TTCAGTGTGATTTTGTTTTCCTATTTTCTGGTGACAGGCGGTATCATATA
TGACGTGATTGTGGAGCCGCCCAGTCTGGGAGCCACGGTGGATGAGCACG
GACACTCGCGTCCAGTGGCCTTTATGCCCTACCGTGTGAATGGGCAGTAC
ATCATGGAGGGCCTGGCCAGCAGCTTCCTGTTCACCGTCGGCGGACTGGG
ATTCATTATCATGGACCAAACGCACACGCCGGGCAAGACGAACCTCAACC
GCCTGCTGCTGACCGCCATGGGATTCATTTTCATCCTGGTCTCCTTCTTC
ACCACCTGGCTGTTCATGCGCATGAAGCTGCCCAGCTACCTGCAGCCCTA
GAATCTCTACTGAAAAACGCTCTCTTAGTACTCTCCCACATTCGAATATC
TGTAAACCGAACTGCATTCGCCAGAAATTCTAGTTTAAAAGGCTTAAAGC
TGCGGAATACCAAACAAAAACTTTGATTTCGTTTTAAAATTTTGTGTAAT
AGTTGTAATATTGTTTAAACAGCAGAATAACTGGCTGGCTTTCATCCGAA
TCAGTTAAGTAAACTATAGAATGTCTCTATTCCGATGCTGTCGAATAAAT
AATGCAATTGTAAAGCGACTCAAAATAACAAAAAAAAAAAAAAAAA

MIP14365.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 09:35:05
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3375452..3376041 829..240 2920 99.7 Minus
chr2L 23010047 chr2L 3376099..3376340 242..1 1165 98.8 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG9662-RB 450 CG9662-PB 1..450 102..551 2250 100 Plus
CG9662-RA 450 CG9662-PA 1..450 102..551 2250 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:35:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG9662-RB 846 CG9662-RB 18..846 1..829 4145 100 Plus
CG9662-RA 795 CG9662-RA 18..795 1..778 3890 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 09:35:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG9662-PB 149 CG9662-PB 1..149 102..548 777 100 Plus
CG9662-PA 149 CG9662-PA 1..149 102..548 777 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 09:35:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3375830..3376421 831..240 2960 100 Minus
2L 23513712 2L 3376479..3376720 242..1 1210 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:57:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3375830..3376421 831..240 2960 100 Minus
2L 23513712 2L 3376479..3376720 242..1 1210 100 Minus
Blast to na_te.dros performed 2014-11-27 09:35:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dtei\I-element 5386 Dtei\I-element DTEII 5386bp 5178..5218 717..677 115 75.6 Minus

MIP14365.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:29:02 Download gff for MIP14365.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3375452..3376040 241..829 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-20 15:54:24 Download gff for MIP14365.complete
Subject Subject Range Query Range Percent Splice Strand
CG9662-RA 1..450 102..551 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:38:15 Download gff for MIP14365.complete
Subject Subject Range Query Range Percent Splice Strand
CG9662-RA 1..450 102..551 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:37:19 Download gff for MIP14365.complete
Subject Subject Range Query Range Percent Splice Strand
CG9662-RA 1..450 102..551 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:29:02 Download gff for MIP14365.complete
Subject Subject Range Query Range Percent Splice Strand
CG9662-RA 1..450 102..551 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-20 15:54:23 Download gff for MIP14365.complete
Subject Subject Range Query Range Percent Splice Strand
CG9662-RA 1..742 35..776 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:38:15 Download gff for MIP14365.complete
Subject Subject Range Query Range Percent Splice Strand
CG9662-RA 1..742 35..776 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:37:19 Download gff for MIP14365.complete
Subject Subject Range Query Range Percent Splice Strand
CG9662-RB 18..846 1..829 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:29:02 Download gff for MIP14365.complete
Subject Subject Range Query Range Percent Splice Strand
CG9662-RB 18..846 1..829 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:29:02 Download gff for MIP14365.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3376481..3376720 1..240 100   Minus
2L 3375832..3376420 241..829 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:37:19 Download gff for MIP14365.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3376481..3376720 1..240 100   Minus
arm_2L 3375832..3376420 241..829 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:41:01 Download gff for MIP14365.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3376481..3376720 1..240 100   Minus
2L 3375832..3376420 241..829 100 <- Minus

MIP14365.pep Sequence

Translation from 101 to 550

> MIP14365.pep
MIETLYNLPFHILVPPNIKVRRFSIPMPSPMAVFSVILFSYFLVTGGIIY
DVIVEPPSLGATVDEHGHSRPVAFMPYRVNGQYIMEGLASSFLFTVGGLG
FIIMDQTHTPGKTNLNRLLLTAMGFIFILVSFFTTWLFMRMKLPSYLQP*

MIP14365.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 07:23:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15682-PA 149 GF15682-PA 1..149 1..149 745 96 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 07:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24442-PA 149 GG24442-PA 1..149 1..149 761 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 07:23:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10468-PA 149 GH10468-PA 1..149 1..149 737 94 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 07:23:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG9662-PB 149 CG9662-PB 1..149 1..149 777 100 Plus
CG9662-PA 149 CG9662-PA 1..149 1..149 777 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 07:23:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15864-PA 149 GI15864-PA 1..149 1..149 722 90.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 07:23:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19520-PA 149 GL19520-PA 1..149 1..149 740 96 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 07:23:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25992-PA 149 GA25992-PA 1..149 1..149 740 96 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 07:23:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18149-PA 149 GM18149-PA 1..149 1..149 766 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 07:23:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22760-PA 149 GD22760-PA 1..149 1..149 766 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 07:23:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10350-PA 149 GJ10350-PA 1..149 1..149 740 94.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 07:23:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14596-PA 149 GK14596-PA 1..149 1..149 740 96 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 07:23:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14881-PA 149 GE14881-PA 1..149 1..149 754 98 Plus

MIP14365.hyp Sequence

Translation from 101 to 550

> MIP14365.hyp
MIETLYNLPFHILVPPNIKVRRFSIPMPSPMAVFSVILFSYFLVTGGIIY
DVIVEPPSLGATVDEHGHSRPVAFMPYRVNGQYIMEGLASSFLFTVGGLG
FIIMDQTHTPGKTNLNRLLLTAMGFIFILVSFFTTWLFMRMKLPSYLQP*

MIP14365.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:52:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG9662-PB 149 CG9662-PB 1..149 1..149 777 100 Plus
CG9662-PA 149 CG9662-PA 1..149 1..149 777 100 Plus