Clone MIP14376 Report

Search the DGRC for MIP14376

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:143
Well:76
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptFen1-RA
Protein status:MIP14376.pep: gold
Sequenced Size:1388

Clone Sequence Records

MIP14376.complete Sequence

1388 bp assembled on 2009-10-12

GenBank Submission: BT100031.1

> MIP14376.complete
TTGGCAAAAAAGCGCGCGGCGTGTTTTCACAAACAAAACAATTTGATAAA
CCCCTGGCTATACTTAATATAATCATATATTTAATTAATTACAAGTGTTA
AGTTAAAATAAAATCGCCATGGGAATTTTGGGCTTATCTAAGCTCATTGC
CGATCTGGCGCCACAGGCGATTCGCGAAAGTGAGATGAAGCATTTTTTCG
GTCGCAAGGTAGCAATCGATGCTAGTATGTGCCTGTACCAGTTCCTCATC
GCCGTGCGCTCCGAAGGCGCCCAGTTGGCCACCGTAAATGGTGATCCCAC
GTCCCACTTAATGGGCATGTTCTACCGCACCATCCGATTGCTGGACAACG
GAATCAAGCCGGTATATGTCTTCGACGGAAAGCCACCAGATCTCAAGTCC
GGTGAGCTGGCGAAGCGCGCCGAGCGGCGGGAGGAAGCGGAGAAGGCACT
GAAGGCGGCCACCGATGCGGGAGATGATGCCGGTATCGAAAAGTTTAATC
GCCGATTGGTCCGGGTAACGAAGGAGCACGCCAAAGAGGCCAAGGAACTG
CTCACACTAATGGGTGTGCCCTATGTTGATGCACCGTGCGAAGCGGAGGC
CCAGTGTGCCGCTCTGGTGAAAGCTGGAAAGGTTTATGCCACCGCCACGG
AGGATATGGATGCCCTCACATTCGGATCTACAAAACTGTTGAGATACCTT
ACCTACAGCGAGGCACGAAAGATGCCCGTCAAGGAGTTCAGCTACGACAA
GCTGTTGGAAGGTCTGGCCATTAACAATCGAGAGTTCATTGATCTATGTA
TTCTGCTGGGTTGCGATTACTGTGAGAGCATCAAGGGTATTGGACCCAAG
CGAGCGATCGAACTGATCAACACCTATCGGGATATAGAGACTATTCTGGA
TAACCTGGACTCTAGCAAATACACCGTGCCCGAGAACTGGAACTACAAGG
TGGCGCGGGAACTCTTCATCGAACCGGAGGTAGCTGATGCCGACTCCATA
GATCTCAAATGGGTCGAGCCGGATGAGGAGGGCCTTGTCAAGTTTCTCTG
CGGCGACCGGCAGTTCAACGAAGAGCGCGTTCGCAACGGTGCCAAAAAGC
TGATGAAATCCAAGCAGGCCCAGACTCAGGTGAGACTCGATAGCTTCTTT
AAGACACTGCCCAGCACTCCGAATGCCACAAACGCTGCAAAACGGAAGGC
CGAGGAAGCAAAGAAGAGCGCCAATAACAAAAAGGCCAAGACCAGCGGCG
GTGGACGAGGCCGGCGACCCAAGTAGTTCATTCGTGTGTTATCTGGAAAA
ACGTACAATTCTTTAATCTTAACTTAACCGTAAAGCCTATGCATACAATA
TAAACTACATCTTTGAGCTTAAAAAAAAAAAAAAAAAA

MIP14376.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:54:20
Subject Length Description Subject Range Query Range Score Percent Strand
Fen1-RA 1436 Fen1-RA 19..1390 1..1372 6860 100 Plus
CG5859-RA 3435 CG5859-RA 3292..3435 1372..1229 720 100 Minus
CG5859.a 3215 CG5859.a 3134..3215 1372..1291 410 100 Minus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 05:08:45
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12741191..12742361 1370..200 5855 100 Minus
chr2R 21145070 chr2R 12742421..12742622 202..1 1010 100 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:08:42
Subject Length Description Subject Range Query Range Score Percent Strand
Fen1-RA 1158 CG8648-PA 1..1158 119..1276 5790 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:54 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:08:41
Subject Length Description Subject Range Query Range Score Percent Strand
Fen1-RA 1378 CG8648-RA 9..1378 1..1370 6850 100 Plus
IntS8-RA 3293 CG5859-RA 3214..3293 1370..1291 400 100 Minus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 05:08:44
Subject Length Description Subject Range Query Range Score Percent Strand
Fen1-PA 385 CG8648-PA 1..385 119..1273 1719 100 Plus
Gen-PA 726 CG10670-PA 1..255 128..913 216 27.8 Plus
mus201-PD 1236 CG10890-PD 849..972 497..877 176 32.3 Plus
mus201-PC 1236 CG10890-PC 849..972 497..877 176 32.3 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 05:08:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16854023..16855195 1372..200 5865 100 Minus
2R 25286936 2R 16855255..16855456 202..1 1010 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16855222..16856394 1372..200 5865 100 Minus
2R 25260384 2R 16856454..16856655 202..1 1010 100 Minus
Blast to na_te.dros performed on 2014-11-27 05:08:40 has no hits.

MIP14376.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 06:29:01 Download gff for MIP14376.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12741191..12742360 201..1370 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:57:39 Download gff for MIP14376.complete
Subject Subject Range Query Range Percent Splice Strand
Fen1-RA 1..1158 119..1276 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:43:32 Download gff for MIP14376.complete
Subject Subject Range Query Range Percent Splice Strand
Fen1-RA 1..1158 119..1276 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:35:43 Download gff for MIP14376.complete
Subject Subject Range Query Range Percent Splice Strand
Fen1-RA 1..1158 119..1276 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:29:01 Download gff for MIP14376.complete
Subject Subject Range Query Range Percent Splice Strand
Fen1-RA 1..1158 119..1276 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-10-12 17:30:33 Download gff for MIP14376.complete
Subject Subject Range Query Range Percent Splice Strand
Fen1-RA 1..1252 119..1370 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:43:31 Download gff for MIP14376.complete
Subject Subject Range Query Range Percent Splice Strand
Fen1-RA 1..1252 119..1370 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:35:43 Download gff for MIP14376.complete
Subject Subject Range Query Range Percent Splice Strand
Fen1-RA 9..1378 1..1370 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:29:01 Download gff for MIP14376.complete
Subject Subject Range Query Range Percent Splice Strand
Fen1-RA 9..1378 1..1370 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 06:29:01 Download gff for MIP14376.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16855257..16855456 1..200 100   Minus
2R 16854025..16855194 201..1370 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:35:43 Download gff for MIP14376.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12742762..12742961 1..200 100   Minus
arm_2R 12741530..12742699 201..1370 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:24:24 Download gff for MIP14376.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16856456..16856655 1..200 100   Minus
2R 16855224..16856393 201..1370 100 <- Minus

MIP14376.pep Sequence

Translation from 118 to 1275

> MIP14376.pep
MGILGLSKLIADLAPQAIRESEMKHFFGRKVAIDASMCLYQFLIAVRSEG
AQLATVNGDPTSHLMGMFYRTIRLLDNGIKPVYVFDGKPPDLKSGELAKR
AERREEAEKALKAATDAGDDAGIEKFNRRLVRVTKEHAKEAKELLTLMGV
PYVDAPCEAEAQCAALVKAGKVYATATEDMDALTFGSTKLLRYLTYSEAR
KMPVKEFSYDKLLEGLAINNREFIDLCILLGCDYCESIKGIGPKRAIELI
NTYRDIETILDNLDSSKYTVPENWNYKVARELFIEPEVADADSIDLKWVE
PDEEGLVKFLCGDRQFNEERVRNGAKKLMKSKQAQTQVRLDSFFKTLPST
PNATNAAKRKAEEAKKSANNKKAKTSGGGRGRRPK*

MIP14376.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 09:42:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13444-PA 388 GF13444-PA 1..376 1..376 1830 93.9 Plus
Dana\GF10471-PA 734 GF10471-PA 1..255 4..263 235 29.1 Plus
Dana\GF14831-PA 714 GF14831-PA 1..383 1..376 188 25.7 Plus
Dana\GF15526-PA 1237 GF15526-PA 849..972 127..253 187 33.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 09:42:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22240-PA 387 GG22240-PA 1..376 1..376 1905 98.4 Plus
Dere\GG14140-PA 726 GG14140-PA 1..250 4..259 228 28 Plus
Dere\GG10553-PA 1237 GG10553-PA 850..973 127..253 182 32.3 Plus
Dere\GG21694-PA 732 GG21694-PA 1..243 1..250 166 27.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 09:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21157-PA 388 GH21157-PA 1..363 1..363 1736 87.9 Plus
Dgri\GH15274-PA 749 GH15274-PA 1..271 4..272 241 30 Plus
Dgri\GH10168-PA 631 GH10168-PA 1..265 1..277 188 27.6 Plus
Dgri\GH10954-PA 1183 GH10954-PA 724..904 74..253 187 31 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 09:42:31
Subject Length Description Subject Range Query Range Score Percent Strand
Fen1-PA 385 CG8648-PA 1..385 1..385 1970 100 Plus
Gen-PA 726 CG10670-PA 1..255 4..265 250 29.7 Plus
mus201-PD 1236 CG10890-PD 824..972 94..253 180 30 Plus
mus201-PC 1236 CG10890-PC 824..972 94..253 180 30 Plus
tos-PA 732 CG10387-PA 1..243 1..250 173 26.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 09:42:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18754-PA 388 GI18754-PA 1..388 1..385 1779 88.1 Plus
Dmoj\GI11983-PA 751 GI11983-PA 1..258 4..263 228 29 Plus
Dmoj\GI10377-PA 1255 GI10377-PA 857..980 127..253 184 32.3 Plus
Dmoj\GI14203-PA 661 GI14203-PA 1..265 1..277 174 26.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 09:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16728-PA 386 GL16728-PA 1..386 1..385 1899 95.6 Plus
Dper\GL22468-PA 754 GL22468-PA 1..252 4..263 230 29.3 Plus
Dper\GL25951-PA 1238 GL25951-PA 851..974 127..253 183 32.3 Plus
Dper\GL18496-PA 709 GL18496-PA 1..284 1..283 172 28.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 09:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27689-PA 386 GA27689-PA 1..386 1..385 1900 95.9 Plus
Dpse\GA10481-PA 754 GA10481-PA 1..252 4..263 234 29.3 Plus
Dpse\GA25201-PA 1236 GA25201-PA 849..972 127..253 183 32.3 Plus
Dpse\GA10293-PA 709 GA10293-PA 1..284 1..283 171 28.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 09:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20026-PA 385 GM20026-PA 1..385 1..385 2033 99.5 Plus
Dsec\GM13928-PA 726 GM13928-PA 1..257 4..267 228 28.4 Plus
Dsec\GM16947-PA 1108 GM16947-PA 721..844 127..253 184 32.3 Plus
Dsec\GM17073-PA 732 GM17073-PA 1..243 1..250 168 26.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 09:42:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25512-PA 385 GD25512-PA 1..385 1..385 2036 99.7 Plus
Dsim\GD13208-PA 726 GD13208-PA 1..255 4..265 237 28.5 Plus
Dsim\GD23543-PA 1235 GD23543-PA 848..971 127..253 184 32.3 Plus
Dsim\GD20054-PA 259 GD20054-PA 3..122 131..253 178 31.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 09:42:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21778-PA 386 GJ21778-PA 1..386 1..385 1804 89.9 Plus
Dvir\GJ12207-PA 747 GJ12207-PA 1..254 4..263 243 29.8 Plus
Dvir\GJ20464-PA 646 GJ20464-PA 1..265 1..277 193 26.6 Plus
Dvir\GJ18024-PA 1238 GJ18024-PA 864..987 127..253 184 32.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 09:42:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21315-PA 388 GK21315-PA 1..354 1..354 1719 92.4 Plus
Dwil\GK20322-PA 722 GK20322-PA 1..251 4..259 249 29.5 Plus
Dwil\GK24343-PA 701 GK24343-PA 1..243 1..250 193 31.8 Plus
Dwil\GK18419-PA 1247 GK18419-PA 860..989 127..259 179 31.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 09:42:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14031-PA 387 GE14031-PA 1..376 1..376 1883 97.3 Plus
Dyak\GE20569-PA 727 GE20569-PA 1..257 4..267 235 28.6 Plus
Dyak\GE18773-PA 1237 GE18773-PA 850..973 127..253 182 32.3 Plus
Dyak\GE12717-PA 730 GE12717-PA 1..265 1..277 171 25.9 Plus

MIP14376.hyp Sequence

Translation from 118 to 1275

> MIP14376.hyp
MGILGLSKLIADLAPQAIRESEMKHFFGRKVAIDASMCLYQFLIAVRSEG
AQLATVNGDPTSHLMGMFYRTIRLLDNGIKPVYVFDGKPPDLKSGELAKR
AERREEAEKALKAATDAGDDAGIEKFNRRLVRVTKEHAKEAKELLTLMGV
PYVDAPCEAEAQCAALVKAGKVYATATEDMDALTFGSTKLLRYLTYSEAR
KMPVKEFSYDKLLEGLAINNREFIDLCILLGCDYCESIKGIGPKRAIELI
NTYRDIETILDNLDSSKYTVPENWNYKVARELFIEPEVADADSIDLKWVE
PDEEGLVKFLCGDRQFNEERVRNGAKKLMKSKQAQTQVRLDSFFKTLPST
PNATNAAKRKAEEAKKSANNKKAKTSGGGRGRRPK*

MIP14376.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:54:37
Subject Length Description Subject Range Query Range Score Percent Strand
Fen1-PA 385 CG8648-PA 1..385 1..385 1970 100 Plus
Gen-PA 726 CG10670-PA 1..255 4..265 250 29.7 Plus
mus201-PD 1236 CG10890-PD 824..972 94..253 180 30 Plus
mus201-PC 1236 CG10890-PC 824..972 94..253 180 30 Plus
tos-PA 732 CG10387-PA 1..243 1..250 173 26.6 Plus