Clone MIP14408 Report

Search the DGRC for MIP14408

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:144
Well:8
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptPGRP-SB2-RA
Protein status:MIP14408.pep: gold
Sequenced Size:706

Clone Sequence Records

MIP14408.complete Sequence

706 bp assembled on 2009-09-28

GenBank Submission: BT099865.1

> MIP14408.complete
ACAACATGAAGCTACAGTTGGCTCTCGTTCTATGTGGATTGACTCTGGCC
TTGGGCCAGATTGTTCCCCGCAGCTCCTGGTGTCCTGTGCCCATCTCGCC
GCGAATGCCCAGGCTCATGGTACCGGTGCGACTGATTATCATCCATCATA
CAGTCACGGCCCCTTGCTTCAATCCGCATCAGTGCCAGTTGGTACTTAGG
CAAATTCGAGCCGATCATATGCGCAGAAAGTTCAGGGATATTGGCTATAA
TTTCCTGATCGGCGGGGATGGTCGAATCTACGAGGGCTTGGGTTTCGGCA
TCCGTGGCGAGCATGCTCCCCGCTATAACAGCCAGTCCATTGGCATTGCT
TTCATTGGCAACTTCCAGACTGGATTACCTCCTTCGCAGATGCTCCAGGC
TGCCCGAACCCTCATCCAAATCGCTGTGCAGCGTCGCCAGGTTTCGCCCA
ACTATTCCGTGGTGGGTCATTGCCAAACGAAGGCCACTGCTTGTCCGGGA
ATACACCTTCTCAACGAGCTCAAAAAGTGGCCAAATTGGCGACCAAAGCC
TTAGGTTTCCATATGAATCATTCGAGTGTTGATGAAAGATGGAGACCCTA
ACATAAATATATCTTGAAACCCATTCTCTGTAGCTAAATTGATGTAAATA
ATTGTACATTTTACCAAATAAACACATTTTTTAGACAAAAAAAAAAAAAA
AAAAAA

MIP14408.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:04
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-SB2-RA 732 PGRP-SB2-RA 65..732 1..668 3340 100 Plus
PGRP-SB2.a 650 PGRP-SB2.a 3..371 1..369 1845 100 Plus
PGRP-SB2.a 650 PGRP-SB2.a 372..650 390..668 1395 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16716256..16716624 1..369 1845 100 Plus
chr3L 24539361 chr3L 16716685..16717001 370..686 1585 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:07:23
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-SB2-RA 549 CG9697-PA 1..549 6..554 2745 100 Plus
PGRP-SB2-RB 576 CG9697-PB 1..576 6..601 2645 96.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:16:58 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:07:21
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-SB2-RA 688 CG9697-RA 3..688 1..686 3430 100 Plus
PGRP-SB2-RB 668 CG9697-RB 3..668 1..686 3095 97.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:07:25
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-SB2-PA 182 CG9697-PA 19..182 60..551 893 100 Plus
PGRP-SB2-PB 191 CG9697-PB 19..191 60..545 562 67.8 Plus
PGRP-SB1-PA 190 CG9681-PA 27..188 60..542 434 51.8 Plus
PGRP-SB2-PB 191 CG9697-PB 116..191 371..598 396 93.4 Plus
PGRP-SA-PB 203 CG11709-PB 60..203 123..551 344 44.4 Plus
PGRP-SA-PA 203 CG11709-PA 60..203 123..551 344 44.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16726543..16726911 1..369 1845 100 Plus
3L 28110227 3L 16726972..16727291 370..689 1600 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:46:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16719643..16720011 1..369 1845 100 Plus
3L 28103327 3L 16720072..16720391 370..689 1600 100 Plus
Blast to na_te.dros performed on 2014-11-27 15:07:20 has no hits.

MIP14408.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:24:02 Download gff for MIP14408.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16716685..16717001 370..686 100   Plus
chr3L 16716256..16716624 1..369 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:27 Download gff for MIP14408.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB2-RA 1..549 6..554 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:20 Download gff for MIP14408.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB2-RA 1..549 6..554 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:57:24 Download gff for MIP14408.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB2-RA 1..549 6..554 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:24:02 Download gff for MIP14408.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB2-RA 1..549 6..554 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 10:33:54 Download gff for MIP14408.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB2-RA 3..556 1..554 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:20 Download gff for MIP14408.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB2-RA 3..688 1..686 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:57:24 Download gff for MIP14408.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB2-RA 3..688 1..686 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:24:02 Download gff for MIP14408.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB2-RA 3..688 1..686 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:24:02 Download gff for MIP14408.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16726972..16727288 370..686 100   Plus
3L 16726543..16726911 1..369 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:57:24 Download gff for MIP14408.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16720072..16720388 370..686 100   Plus
arm_3L 16719643..16720011 1..369 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:20 Download gff for MIP14408.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16720072..16720388 370..686 100   Plus
3L 16719643..16720011 1..369 100 -> Plus

MIP14408.pep Sequence

Translation from 2 to 553

> MIP14408.pep
NMKLQLALVLCGLTLALGQIVPRSSWCPVPISPRMPRLMVPVRLIIIHHT
VTAPCFNPHQCQLVLRQIRADHMRRKFRDIGYNFLIGGDGRIYEGLGFGI
RGEHAPRYNSQSIGIAFIGNFQTGLPPSQMLQAARTLIQIAVQRRQVSPN
YSVVGHCQTKATACPGIHLLNELKKWPNWRPKP*

MIP14408.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:39:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23927-PA 182 GF23927-PA 1..182 2..183 810 82.4 Plus
Dana\GF10506-PA 187 GF10506-PA 10..185 8..180 462 51.7 Plus
Dana\GF12377-PA 185 GF12377-PA 5..185 2..181 360 40.9 Plus
Dana\GF21644-PA 185 GF21644-PA 5..185 2..181 360 40.9 Plus
Dana\GF21643-PA 185 GF21643-PA 5..185 2..181 360 40.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:39:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13574-PA 182 GG13574-PA 1..182 2..183 898 92.9 Plus
Dere\GG15854-PA 190 GG15854-PA 12..188 7..180 478 52.5 Plus
Dere\GG23381-PA 184 GG23381-PA 9..184 6..181 354 37.3 Plus
Dere\GG23379-PA 185 GG23379-PA 5..185 2..181 352 39.8 Plus
Dere\GG23380-PA 185 GG23380-PA 7..183 4..179 350 40.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:39:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15225-PA 191 GH15225-PA 6..189 2..180 456 48.4 Plus
Dgri\GH20540-PA 184 GH20540-PA 9..184 6..181 373 39.5 Plus
Dgri\GH21355-PA 184 GH21355-PA 9..184 6..181 371 40.3 Plus
Dgri\GH21354-PA 184 GH21354-PA 9..184 6..181 370 40.7 Plus
Dgri\GH17605-PA 199 GH17605-PA 56..199 41..183 348 44.4 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:39:14
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-SB2-PA 182 CG9697-PA 1..182 2..183 979 100 Plus
PGRP-SB2-PB 191 CG9697-PB 1..191 2..181 648 70.8 Plus
PGRP-SB1-PA 190 CG9681-PA 12..188 7..180 456 52 Plus
PGRP-SA-PB 203 CG11709-PB 60..203 41..183 344 44.4 Plus
PGRP-SA-PA 203 CG11709-PA 60..203 41..183 344 44.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:39:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11935-PA 191 GI11935-PA 17..190 8..181 466 50.3 Plus
Dmoj\GI20770-PA 184 GI20770-PA 7..184 4..181 381 40.4 Plus
Dmoj\GI16473-PA 207 GI16473-PA 64..207 41..183 364 44.4 Plus
Dmoj\GI18809-PA 184 GI18809-PA 7..184 4..181 362 38.5 Plus
Dmoj\GI18808-PA 187 GI18808-PA 7..187 2..181 340 39.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:39:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13286-PA 130 GL13286-PA 1..130 54..183 566 80 Plus
Dper\GL17120-PA 185 GL17120-PA 5..183 2..179 345 39.7 Plus
Dper\GL17117-PA 185 GL17117-PA 5..183 2..179 345 39.7 Plus
Dper\GL12268-PA 310 GL12268-PA 118..279 19..179 345 41.3 Plus
Dper\GL26887-PA 200 GL26887-PA 36..200 19..183 341 39.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21970-PA 182 GA21970-PA 15..182 16..183 711 78 Plus
Dpse\GA21961-PA 188 GA21961-PA 4..187 1..181 462 49.5 Plus
Dpse\GA13217-PA 184 GA13217-PA 9..184 6..181 374 41 Plus
Dpse\GA24974-PA 185 GA24974-PA 5..183 2..179 345 39.7 Plus
Dpse\GA21174-PA 185 GA21174-PA 5..183 2..179 345 39.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25654-PA 182 GM25654-PA 1..182 2..183 926 96.7 Plus
Dsec\GM24370-PA 190 GM24370-PA 12..188 7..180 473 51.4 Plus
Dsec\GM26096-PA 232 GM26096-PA 24..192 12..179 345 39.7 Plus
Dsec\GM21060-PA 185 GM21060-PA 5..183 2..179 342 39.1 Plus
Dsec\GM21059-PA 185 GM21059-PA 5..183 2..179 340 39.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:39:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\PGRP-SB2-PA 182 GD14659-PA 1..182 2..183 930 96.7 Plus
Dsim\PGRP-SB1-PA 190 GD12445-PA 12..188 7..180 476 52 Plus
Dsim\PGRP-SC2-PA 184 GD10595-PA 9..184 6..181 366 39 Plus
Dsim\PGRP-SA-PA 202 GD17030-PA 59..202 41..183 355 43.8 Plus
Dsim\PGRP-SC1a-PA 185 GD10593-PA 5..183 2..179 341 39.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12160-PA 191 GJ12160-PA 16..189 7..180 447 49.2 Plus
Dvir\GJ20505-PA 184 GJ20505-PA 9..184 6..181 372 41.4 Plus
Dvir\GJ21836-PA 184 GJ21836-PA 9..184 6..181 370 38.4 Plus
Dvir\GJ15950-PA 196 GJ15950-PA 53..196 41..183 351 43.8 Plus
Dvir\GJ10054-PA 214 GJ10054-PA 35..198 17..179 337 40.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:39:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17119-PA 173 GK17119-PA 2..173 12..183 737 80.2 Plus
Dwil\GK17343-PA 192 GK17343-PA 11..190 4..180 451 49.5 Plus
Dwil\GK21737-PA 185 GK21737-PA 8..185 4..181 379 39.7 Plus
Dwil\GK25449-PA 199 GK25449-PA 32..197 19..183 346 38.6 Plus
Dwil\GK11791-PA 212 GK11791-PA 52..192 41..179 341 44.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:39:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19871-PA 184 GE19871-PA 1..184 2..183 857 89.1 Plus
Dyak\GE22193-PA 190 GE22193-PA 12..188 7..180 484 52 Plus
Dyak\GE19223-PA 184 GE19223-PA 9..184 6..181 363 38.4 Plus
Dyak\PGRP-SA-PA 202 GE15944-PA 59..202 41..183 354 43.8 Plus
Dyak\GE19221-PA 185 GE19221-PA 5..183 2..179 348 39.7 Plus

MIP14408.hyp Sequence

Translation from 2 to 553

> MIP14408.hyp
NMKLQLALVLCGLTLALGQIVPRSSWCPVPISPRMPRLMVPVRLIIIHHT
VTAPCFNPHQCQLVLRQIRADHMRRKFRDIGYNFLIGGDGRIYEGLGFGI
RGEHAPRYNSQSIGIAFIGNFQTGLPPSQMLQAARTLIQIAVQRRQVSPN
YSVVGHCQTKATACPGIHLLNELKKWPNWRPKP*

MIP14408.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:22:28
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-SB2-PA 182 CG9697-PA 1..182 2..183 979 100 Plus
PGRP-SB2-PB 191 CG9697-PB 1..191 2..181 648 70.8 Plus
PGRP-SB1-PA 190 CG9681-PA 12..188 7..180 456 52 Plus
PGRP-SA-PB 203 CG11709-PB 60..203 41..183 344 44.4 Plus
PGRP-SA-PA 203 CG11709-PA 60..203 41..183 344 44.4 Plus