Clone MIP14469 Report

Search the DGRC for MIP14469

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:144
Well:69
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptVAChT-RA
Protein status:MIP14469.pep: gold
Sequenced Size:2954

Clone Sequence Records

MIP14469.complete Sequence

2954 bp assembled on 2010-01-06

GenBank Submission: BT120106.1

> MIP14469.complete
CACGCTGCTGCTGTAACGCCGTAGTCGCCGTCCGTCGCCTGGAAAAAGAA
CTCCCCGGAGCTACATTGTATAGCCAGGAATAGAAAAAAAAAAAAATAAA
TAAAAGAAGTATCATTTTTTGTGGACAAGCTCAGCCAGGGAAATCCAAGC
GAACGAGCGGTCGAGCGAAGCGGTTGCATTGCGGGTAGAGTGTCAGTGTG
TGTGTGTTTTGGCGTCGGTGTGAGCGTCTTGGCGATCGATTAGCGCGCGC
TGCCCTTTTACATAATCGCAGCGAGAAAAGTCCGCGCGCTTTCGTGTGCT
ATTTGCTTTTGGGTGATTTGGGCGATCATCCCAAGCGACAAAGAAAAAGG
GGCCAAACCAACCGGATCCGAAAGGAGCGAACGTGGCGTCCAACGAGGCC
AGCACCAGCGCAGCGGGCAGTGGCCCGGAGTCCGCCGCCCTGTTCTCCAA
GTTGCGTAGCTTCTCCATTGGCAGCGGGCCGAACTCGCCGCAGCGCGTCG
TCTCCAATCTCCGAGGATTCCTCACCCATCGCCTCAGCAACATCACACCG
AGCGATACAGGTTGTTCACTGGCATGCCAACAACTCGTACACCTCCAACT
ACAACAAGCACACCAAAACATGTAAAACCACACAGCAACAACATCAAGAG
CAGGAGCAAACAATACAGTTAACCACAAGCAACGATAAACCACCTCAGAG
CGGGCAATTAGCGGAGCGGAAACGGAAGCGGCCATATTCGTAGCGAGAGC
TAAGCAATTTCCGGCTGTAAGAATGGCAAGCCCGCCGATCGGCGCATAAA
AGCTTTAAGGCAACAGAGAAGAGTACAAACAAGGAAAAGAAGAGAGGCAG
AGAGAGAGAGAGAGAGAGAGGGAGAGGAAGTCCCAAAGAAACTGGATCAG
AACTTTGTACACCTCAGCAATTGAAATTAATTAATTGCAACCAAAATGGC
CTCATTCCAAATACCTGTTATCAACCTGGAGGTGCGCGAGGTCAAGGACA
TCGTGTGGGAGAAGATCCAGGAGCCGGTGAACCAGCGACGCCTCATCCTC
GTGATTGTATCGATAGCCCTGCTGCTGGACAACATGCTGTATATGGTGAT
AGTACCGATTATACCCGACTATTTAAGAGAGATTGGCAGCTTCGATGACG
GGCCGACGCCTCCACCGTTGAGGGATAATATCACGGGAAAGATCATACCC
GTGCATCATGATCATCACGGGCAGGACTCGGCCACGGGCATCCTATTCGC
CTCGAAGGCCATCGTCCAGCTGATGGTGAATCCGTTTTCGGGCGGCCTCA
TCGACAAGATCGGCTACGATTTGCCCATGATGATCGGCCTGACCATCATG
TTCTTCTCGACGGCAGTCTTTGCTTGTGGCAGCAGCTACAGTGTCCTGTT
CTTCGCCCGATCCCTGCAGGGAGCCGGTTCCGCCTTTGCGGACACCGCCG
GTTTGGCCATGATAGCCGATCGGTTCACCGAGGAGAACGAACGTTCGCAG
GCCCTTGGCATTGCGTTGGCCTTCATCAGTTTCGGATGCCTGGTGGCGCC
TCCGTTTGGCGGAGCGCTCTACCAGTTCGCCGGAAAGGAAGTGCCCTTTC
TGATCCTGGCACTGGTGTGCCTACTGGACGGGCTGATGCTGCTGCTGGTG
ATGAAACCGGTCAAGGAGGCGATGAAGCAAAGCAAGGATGTGCAGGACCA
AGTAATACCCATCTGGCGCCTGCTGATGGATCCCTATATTGCAGTCTGTG
CCGGGGCACTGACCATGTCCAATGTGGCGCTGGCCTTTCTGGAGCCAACC
ATTTCGCTGTGGATGGAGGATAACATGACCACTGACAACTGGAAGATCGG
CATGGTCTGGCTGCCCGCCTTCTTCCCACACGTGCTGGGCGTGGTCATTA
CGGTGAAGATGGCCCGCAAGTATCCGCAGCACCAGTGGCTAATGGCTGCC
GGTGGATTGGCCCTGGAGGGCTTCTCCTGCTTCATCATACCATTCTGCAG
CGGCTACAAGATGCTCATGCTGCCCATCTGTGTGATCTGCTTCGGAATTG
CCCTAATAGACACGGCTCTACTACCCACACTCGGTTATCTGGTGGACGTG
CGATATGTGTCGGTGTACGGTAGTATCTATGCCATAGCAGATATATCCTA
CTCGATCGCCTATGCCGTAGGGCCCATTATCGCCGGCGGAGTGGTGGAGG
CCATTGGGTTTACGGCTCTCAACTTTTTGATAGCCTTCTCGAATCTGGCC
TATGTGCCCGTGCTGCGAAAGCTGCGCAACATCTACGACTTCAAGCCGTT
CGAGAATGAGGCCAACATCCTGATGCAGGACCCGCCCAACAAAGAGTACC
AGACCTATGTGATGCACGACCAGAAACCCGTCGAGGGTGGCGTCAAGAAT
CATCTGGAGTACGGCCAGCAGTATCAGCAGGAGCAGGAGACGAATCTGGA
TGACCAGCAGTACGAGTACCAGCAGCAGCAGCAGGGATACCAGCAAGGAT
ATCAGCAGGATCAGGGCTACCAGCCGGGCTATCAGGAGCAGGGCGGCAGC
TACGCCCCGCAAGGTCAGCCCCGTGTGGCCAATCCCTTCCAGCAGCAGCA
GCAGCAGCAACAACAACAACAGCAGCAGGTCCAGAGCAGAGGTCCTGCCG
CCCCAGCGAATCCCTTTAGGCAAGGATTTTAAACTGTTGCCCCGAACAGA
TACTCCTAGTTTTAAATCGTGTTCTTTTGCACACCTCCGTGTGCAATATT
CTGTTCTCTGTTGAATCCACCCACACCCACACACCCATAAACACACACCC
AACCACCACAACAGAAACAGAGGACAAACAACACAAAACAAACATGTACT
ATTGAAATATAATTGTTAACCATGGAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAA

MIP14469.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:17:56
Subject Length Description Subject Range Query Range Score Percent Strand
VAChT-RA 7147 VAChT-RA 95..2865 1..2770 13815 99.9 Plus
CG12345-RB 2807 CG12345-RB 13..574 1..561 2770 99.8 Plus
VAChT-RA 7147 VAChT-RA 7039..7147 2767..2875 545 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 08:55:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 14536554..14538750 559..2755 10970 100 Plus
chr3R 27901430 chr3R 14529683..14530245 1..562 2765 99.8 Plus
chr3R 27901430 chr3R 14542930..14543038 2767..2875 545 100 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 08:55:48
Subject Length Description Subject Range Query Range Score Percent Strand
VAChT-RA 1737 CG32848-PA 1..1737 946..2682 8685 100 Plus
Cha-RA 2166 CG12345-PA 1..179 383..561 895 100 Plus
Cha-RB 2145 CG12345-PB 1..179 383..561 895 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:17:07 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 08:55:46
Subject Length Description Subject Range Query Range Score Percent Strand
VAChT-RA 7098 CG32848-RA 46..2816 1..2770 13805 100 Plus
Cha-RA 4011 CG12345-RA 46..607 1..561 2760 99.8 Plus
Cha-RB 2824 CG12345-RB 46..607 1..561 2760 99.8 Plus
VAChT-RA 7098 CG32848-RA 6990..7098 2767..2875 545 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 08:55:51
Subject Length Description Subject Range Query Range Score Percent Strand
VAChT-PA 578 CG32848-PA 1..578 946..2679 2397 100 Plus
Vmat-PC 610 CG33528-PC 152..608 1078..2373 694 37.4 Plus
Vmat-PE 610 CG33528-PE 152..608 1078..2373 694 37.4 Plus
Vmat-PF 610 CG33528-PF 152..608 1078..2373 694 37.4 Plus
Vmat-PD 646 CG33528-PD 152..579 1078..2280 689 38.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 08:55:43
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 18712423..18714634 559..2770 11060 100 Plus
3R 32079331 3R 18705546..18706108 1..562 2765 99.8 Plus
3R 32079331 3R 18718808..18718921 2767..2880 570 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:35:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 18453254..18455465 559..2770 11060 100 Plus
3R 31820162 3R 18446377..18446939 1..562 2775 99.8 Plus
3R 31820162 3R 18459639..18459752 2767..2880 570 100 Plus
Blast to na_te.dros performed 2014-11-27 08:55:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1476..1595 548..665 153 63.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1513..1600 606..693 132 66.7 Plus

MIP14469.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 10:17:57 Download gff for MIP14469.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 14542962..14543038 2799..2875 100   Plus
chr3R 14538510..14538750 2515..2755 83 == Plus
chr3R 14536556..14538410 561..2415 98 == Plus
chr3R 14529683..14530243 1..560 95 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 17:22:18 Download gff for MIP14469.complete
Subject Subject Range Query Range Percent Splice Strand
VAChT-RA 1..1737 946..2682 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:26:41 Download gff for MIP14469.complete
Subject Subject Range Query Range Percent Splice Strand
VAChT-RA 1..1737 946..2682 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:02:44 Download gff for MIP14469.complete
Subject Subject Range Query Range Percent Splice Strand
VAChT-RA 1..1737 946..2682 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:17:57 Download gff for MIP14469.complete
Subject Subject Range Query Range Percent Splice Strand
VAChT-RA 1..1737 946..2682 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 17:22:17 Download gff for MIP14469.complete
Subject Subject Range Query Range Percent Splice Strand
VAChT-RA 95..2866 1..2770 99 <- Plus
VAChT-RA 7043..7147 2771..2875 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:26:41 Download gff for MIP14469.complete
Subject Subject Range Query Range Percent Splice Strand
VAChT-RA 7043..7147 2771..2875 100   Plus
VAChT-RA 95..2866 1..2770 99 <- Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:02:44 Download gff for MIP14469.complete
Subject Subject Range Query Range Percent Splice Strand
VAChT-RA 7043..7147 2771..2875 100   Plus
VAChT-RA 95..2866 1..2770 99 <- Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:17:57 Download gff for MIP14469.complete
Subject Subject Range Query Range Percent Splice Strand
VAChT-RA 6994..7098 2771..2875 100   Plus
VAChT-RA 46..2817 1..2770 99 <- Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 10:17:57 Download gff for MIP14469.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18718812..18718916 2771..2875 100   Plus
3R 18712425..18714635 561..2770 99 <- Plus
3R 18705546..18706106 1..560 99 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:02:44 Download gff for MIP14469.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 14544534..14544638 2771..2875 100   Plus
arm_3R 14538147..14540357 561..2770 99 <- Plus
arm_3R 14531268..14531828 1..560 99 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:59:11 Download gff for MIP14469.complete
Subject Subject Range Query Range Percent Splice Strand
3R 18459643..18459747 2771..2875 100   Plus
3R 18453256..18455466 561..2770 99 <- Plus
3R 18446377..18446937 1..560 99 -> Plus

MIP14469.pep Sequence

Translation from 945 to 2681

> MIP14469.pep
MASFQIPVINLEVREVKDIVWEKIQEPVNQRRLILVIVSIALLLDNMLYM
VIVPIIPDYLREIGSFDDGPTPPPLRDNITGKIIPVHHDHHGQDSATGIL
FASKAIVQLMVNPFSGGLIDKIGYDLPMMIGLTIMFFSTAVFACGSSYSV
LFFARSLQGAGSAFADTAGLAMIADRFTEENERSQALGIALAFISFGCLV
APPFGGALYQFAGKEVPFLILALVCLLDGLMLLLVMKPVKEAMKQSKDVQ
DQVIPIWRLLMDPYIAVCAGALTMSNVALAFLEPTISLWMEDNMTTDNWK
IGMVWLPAFFPHVLGVVITVKMARKYPQHQWLMAAGGLALEGFSCFIIPF
CSGYKMLMLPICVICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADI
SYSIAYAVGPIIAGGVVEAIGFTALNFLIAFSNLAYVPVLRKLRNIYDFK
PFENEANILMQDPPNKEYQTYVMHDQKPVEGGVKNHLEYGQQYQQEQETN
LDDQQYEYQQQQQGYQQGYQQDQGYQPGYQEQGGSYAPQGQPRVANPFQQ
QQQQQQQQQQQVQSRGPAAPANPFRQGF*

MIP14469.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 12:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11179-PA 611 GF11179-PA 137..609 29..476 864 38.7 Plus
Dana\GF18748-PA 581 GF18748-PA 212..561 93..460 452 31.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 12:22:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22485-PA 613 GG22485-PA 140..611 30..476 864 39 Plus
Dere\GG12415-PA 592 GG12415-PA 223..592 93..480 460 31.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 12:23:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23496-PA 573 GH23496-PA 1..573 1..578 2632 93 Plus
Dgri\GH17299-PA 619 GH17299-PA 143..617 29..476 870 39.1 Plus
Dgri\GH13912-PA 567 GH13912-PA 172..550 93..462 530 33.8 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:22:54
Subject Length Description Subject Range Query Range Score Percent Strand
VAChT-PA 578 CG32848-PA 1..578 1..578 3012 100 Plus
Vmat-PC 610 CG33528-PC 139..608 32..476 857 38.7 Plus
Vmat-PE 610 CG33528-PE 139..608 32..476 857 38.7 Plus
Vmat-PF 610 CG33528-PF 139..608 32..476 857 38.7 Plus
Vmat-PD 646 CG33528-PD 139..579 32..445 852 40 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 12:23:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21330-PA 621 GI21330-PA 146..619 30..476 886 39.4 Plus
Dmoj\GI24831-PA 538 GI24831-PA 168..521 93..462 458 33.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 12:23:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17068-PA 615 GL17068-PA 141..613 29..476 859 38.8 Plus
Dper\GL13834-PA 563 GL13834-PA 193..563 93..480 408 29.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 12:23:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17179-PB 581 GA17179-PB 1..581 1..578 2681 93.5 Plus
Dpse\GA24351-PA 616 GA24351-PA 142..614 29..476 858 38.8 Plus
Dpse\GA10193-PB 586 GA10193-PB 193..569 93..462 497 31.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 12:23:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20272-PA 578 GM20272-PA 140..412 30..273 523 41.9 Plus
Dsec\GM20272-PA 578 GM20272-PA 405..522 332..460 226 34.9 Plus
Dsec\GM23549-PA 491 GM23549-PA 212..491 177..480 200 25 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 12:23:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25754-PA 613 GD25754-PA 140..611 30..476 859 38.8 Plus
Dsim\GD18364-PA 571 GD18364-PA 215..561 93..457 453 32.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 12:23:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14407-PA 562 GJ14407-PA 1..562 1..578 2651 90.2 Plus
Dvir\GJ19675-PA 614 GJ19675-PA 139..611 30..475 864 38.6 Plus
Dvir\GJ24475-PA 533 GJ24475-PA 29..516 28..462 492 30.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 12:23:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15611-PA 612 GK15611-PA 138..610 29..476 851 38.7 Plus
Dwil\GK14095-PA 579 GK14095-PA 206..561 93..461 454 32.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 12:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13356-PA 498 GE13356-PA 81..442 87..460 783 41.3 Plus
Dyak\GE23934-PA 588 GE23934-PA 215..588 93..480 458 30.7 Plus

MIP14469.hyp Sequence

Translation from 945 to 2681

> MIP14469.hyp
MASFQIPVINLEVREVKDIVWEKIQEPVNQRRLILVIVSIALLLDNMLYM
VIVPIIPDYLREIGSFDDGPTPPPLRDNITGKIIPVHHDHHGQDSATGIL
FASKAIVQLMVNPFSGGLIDKIGYDLPMMIGLTIMFFSTAVFACGSSYSV
LFFARSLQGAGSAFADTAGLAMIADRFTEENERSQALGIALAFISFGCLV
APPFGGALYQFAGKEVPFLILALVCLLDGLMLLLVMKPVKEAMKQSKDVQ
DQVIPIWRLLMDPYIAVCAGALTMSNVALAFLEPTISLWMEDNMTTDNWK
IGMVWLPAFFPHVLGVVITVKMARKYPQHQWLMAAGGLALEGFSCFIIPF
CSGYKMLMLPICVICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADI
SYSIAYAVGPIIAGGVVEAIGFTALNFLIAFSNLAYVPVLRKLRNIYDFK
PFENEANILMQDPPNKEYQTYVMHDQKPVEGGVKNHLEYGQQYQQEQETN
LDDQQYEYQQQQQGYQQGYQQDQGYQPGYQEQGGSYAPQGQPRVANPFQQ
QQQQQQQQQQQVQSRGPAAPANPFRQGF*

MIP14469.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
VAChT-PA 578 CG32848-PA 1..578 1..578 3012 100 Plus
Vmat-PC 610 CG33528-PC 139..608 32..476 857 38.7 Plus
Vmat-PE 610 CG33528-PE 139..608 32..476 857 38.7 Plus
Vmat-PF 610 CG33528-PF 139..608 32..476 857 38.7 Plus
Vmat-PD 646 CG33528-PD 139..579 32..445 852 40 Plus