Clone MIP14536 Report

Search the DGRC for MIP14536

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:145
Well:36
Vector:pOT2|pOTB7_DraIII
Associated Gene/Transcriptyellow-e2-RB
Protein status:MIP14536.pep: gold
Sequenced Size:1560

Clone Sequence Records

MIP14536.complete Sequence

1560 bp assembled on 2009-09-28

GenBank Submission: BT099877.1

> MIP14536.complete
TAAGGATCTCTCATCGTGCCAAACACCTCTTAAAATGCTTATTCTAGCCC
TTGTTGTGTGGCTCGCTTACCCAAATCTTTGCTTGGCCCAGTACCACCTT
AATCCTCCCAAGACCATCTTTCCGGACTTCAAGTTTCCCTCGGATTATAG
GGATACACCCATAGTTTTTGAATGGAAGAATCTGCAGTACGGCTTCCCCA
GTGAACAGGAACGCGATCAGGTGCTCCGGAATGGTCGCTATAATCCGGAT
AGTCCCATACCCATAGACATCGATGTTTATTATCCACCTAATGGCGGTCC
ACCTAGACACTTTGTGACATCGCCTCGCTTCGGACAGGGAGTTCCCTTTT
CCCTGGGCTATGTGACCAATGTGCAGCGGGAGAACGGAAGTGAAATCCAG
GCCTATCCTAGCTACCAGTGGCACAGTAGCCACGGAGCGAATTGCGATGG
TCTAACGTCCGTGTACCGGGTTCATATCGATGCCTGTGGTCAGATGTGGG
TGCTGGACAGCGGTGAAATTGAGTTCGTGCAGCACTGTGCCCCACAGGTT
ATGGTCTTCGACTTGGCCACCGATCAGTTGATCCATCGGTATCGTCTGCC
CGAAACATCCTATAAGGCGAAGGTCAGTAGATTTGTGAATATATTTGCAG
ACATCAGGGACCCACCGCCAAGTGGGCAGTGCAAGGATGTATTTGCCTAT
CTGGCGGATCCCACAAGTAAGGCCATAGTGGTGTACGATGTCGTGGGTCA
GAGCTCCTGGCGCATCGAGAACAAATTCACCTATCCGGATGCTAAGTTCG
GAACGCACACAGTGGCTGGTGAGAGTTTTGAGCTGCTCGATGGACCTTTG
GCTTTGGCGACGACTCCTTTGGGACTGGGATTGCGCCGCCATCTGATTTT
CCACGCGCTGTCCAACGAACTGGAGCTGGCCATTCCTTTGGATATCCTAA
ATAATGCCACGAATTGGCAAAAGGGTCTGAGCTCCTCCCTGTCGGAATTC
ACTGTCTTGGGTAAGAGAGGGATTCAGTGTGCCTCGCATGCGATAAGCAG
ACAAGGATTCCTGTTCTGTGGCTTCCTGGAGCCAATCGGAATTTTCGGCT
GGGACATACGAAGGCCCTACAATCGCGAAAATGTCAAGCTACTTGCTATT
AATCCGGCTACGCTGCAATTTGTGAGTGGCATGAAGATTGTCCGCAGACC
TGCTGATGGACGGGAGGAACTGTGGCTGCTCTCCGATCGACTGCAGAAGA
TATTCGCCGGAACCATTGACTACAGGGAAATCAATTATCGGGTGATGCGG
TGCGATGTTGATGACCTGTTGCAGGGGCGGGGCTGCTTTTAGGTGCCCAA
TTCCTAATGCCCAGACACCCTCGAGATCTGTGTAAATACTTTTAAAGCCG
ACATAAAAGATGTCCATCTATAAATCTTGGGACGATTCGAAAGTGTTTGC
TTGACCGCCACAGGTACACGACCTTTGTCTTTGGGTTTGATGGTCCATGT
TACACTCGCAAAAATAAATACCAAAATGCCAAACACTCTTAAAAAAAAAA
AAAAAAAAAA

MIP14536.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-e2.a 1696 yellow-e2.a 89..1628 1..1540 7700 100 Plus
yellow-e2-RA 1281 yellow-e2-RA 31..1281 92..1342 6255 100 Plus
Blast to d_melanogaster_OreR.fa performed 2014-11-27 15:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9230329..9231592 1540..277 6185 99.3 Minus
chr3R 27901430 chr3R 9231833..9232087 291..37 1200 98 Minus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:07:42
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-e2-RB 1308 CG17044-PB 1..1308 35..1342 6540 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:17:13 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:07:41
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-e2-RB 1571 CG17044-RB 32..1571 1..1540 7700 100 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 15:07:44
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-e2-PB 435 CG17044-PB 1..435 35..1339 2136 100 Plus
yellow-d2-PA 412 CG9891-PA 25..411 164..1336 1000 53.3 Plus
yellow-d-PA 432 CG9889-PA 5..416 26..1327 812 39.8 Plus
yellow-e3-PA 409 CG17045-PA 56..397 296..1336 514 32.5 Plus
yellow-h-PA 463 CG1629-PA 55..440 161..1336 464 30.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 15:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13405109..13406372 1540..277 6290 99.8 Minus
3R 32079331 3R 13406614..13406868 291..37 1260 99.6 Minus
3R 32079331 3R 13406931..13406967 37..1 185 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:47:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13145940..13147203 1540..277 6290 99.8 Minus
3R 31820162 3R 13147445..13147699 291..37 1260 99.6 Minus
3R 31820162 3R 13147762..13147798 37..1 185 100 Minus
Blast to na_te.dros performed 2014-11-27 15:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
Ivk 5402 Ivk IVK 5402bp 2433..2501 884..815 140 68.6 Minus

MIP14536.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 16:24:07 Download gff for MIP14536.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9232151..9232186 1..36 97   Minus
chr3R 9231837..9232087 37..287 98 <- Minus
chr3R 9230329..9231581 288..1540 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 17:55:49 Download gff for MIP14536.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-e2-RA 23..1281 86..1342 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 14:34:49 Download gff for MIP14536.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-e2-RB 1..1308 35..1342 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:57:31 Download gff for MIP14536.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-e2-RB 1..1308 35..1342 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:24:07 Download gff for MIP14536.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-e2-RB 1..1308 35..1342 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-09-28 11:46:16 Download gff for MIP14536.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-e2-RA 23..1281 86..1342 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 14:34:49 Download gff for MIP14536.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-e2-RB 1..1540 1..1540 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:57:31 Download gff for MIP14536.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-e2-RB 1..1540 1..1540 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:24:07 Download gff for MIP14536.complete
Subject Subject Range Query Range Percent Splice Strand
yellow-e2-RB 32..1571 1..1540 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 16:24:07 Download gff for MIP14536.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13406932..13406967 1..36 100   Minus
3R 13406618..13406868 37..287 100 <- Minus
3R 13405109..13406361 288..1540 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:57:31 Download gff for MIP14536.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9232654..9232689 1..36 100   Minus
arm_3R 9232340..9232590 37..287 100 <- Minus
arm_3R 9230831..9232083 288..1540 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:18:36 Download gff for MIP14536.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13147763..13147798 1..36 100   Minus
3R 13147449..13147699 37..287 100 <- Minus
3R 13145940..13147192 288..1540 100 <- Minus

MIP14536.hyp Sequence

Translation from 0 to 1341

> MIP14536.hyp
KDLSSCQTPLKMLILALVVWLAYPNLCLAQYHLNPPKTIFPDFKFPSDYR
DTPIVFEWKNLQYGFPSEQERDQVLRNGRYNPDSPIPIDIDVYYPPNGGP
PRHFVTSPRFGQGVPFSLGYVTNVQRENGSEIQAYPSYQWHSSHGANCDG
LTSVYRVHIDACGQMWVLDSGEIEFVQHCAPQVMVFDLATDQLIHRYRLP
ETSYKAKVSRFVNIFADIRDPPPSGQCKDVFAYLADPTSKAIVVYDVVGQ
SSWRIENKFTYPDAKFGTHTVAGESFELLDGPLALATTPLGLGLRRHLIF
HALSNELELAIPLDILNNATNWQKGLSSSLSEFTVLGKRGIQCASHAISR
QGFLFCGFLEPIGIFGWDIRRPYNRENVKLLAINPATLQFVSGMKIVRRP
ADGREELWLLSDRLQKIFAGTIDYREINYRVMRCDVDDLLQGRGCF*

MIP14536.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:36:44
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-e2-PB 435 CG17044-PB 1..435 12..446 2342 100 Plus
yellow-d2-PA 412 CG9891-PA 25..411 55..445 1123 53.3 Plus
yellow-d-PA 432 CG9889-PA 5..416 9..442 872 40.3 Plus
yellow-e3-PA 409 CG17045-PA 27..397 57..445 552 32.1 Plus
yellow-h-PA 463 CG1629-PA 55..440 54..445 513 30.9 Plus

MIP14536.pep Sequence

Translation from 1 to 1341

> MIP14536.pep
KDLSSCQTPLKMLILALVVWLAYPNLCLAQYHLNPPKTIFPDFKFPSDYR
DTPIVFEWKNLQYGFPSEQERDQVLRNGRYNPDSPIPIDIDVYYPPNGGP
PRHFVTSPRFGQGVPFSLGYVTNVQRENGSEIQAYPSYQWHSSHGANCDG
LTSVYRVHIDACGQMWVLDSGEIEFVQHCAPQVMVFDLATDQLIHRYRLP
ETSYKAKVSRFVNIFADIRDPPPSGQCKDVFAYLADPTSKAIVVYDVVGQ
SSWRIENKFTYPDAKFGTHTVAGESFELLDGPLALATTPLGLGLRRHLIF
HALSNELELAIPLDILNNATNWQKGLSSSLSEFTVLGKRGIQCASHAISR
QGFLFCGFLEPIGIFGWDIRRPYNRENVKLLAINPATLQFVSGMKIVRRP
ADGREELWLLSDRLQKIFAGTIDYREINYRVMRCDVDDLLQGRGCF*

MIP14536.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 05:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19909-PA 404 GF19909-PA 13..404 55..446 1887 86.5 Plus
Dana\GF11858-PA 411 GF11858-PA 19..411 50..446 1113 51.3 Plus
Dana\GF11856-PA 428 GF11856-PA 28..412 50..442 913 43 Plus
Dana\GF17381-PA 418 GF17381-PA 26..408 46..445 589 31.5 Plus
Dana\GF14904-PA 438 GF14904-PA 31..436 56..445 429 26.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 05:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17051-PA 440 GG17051-PA 7..440 13..446 2135 89.9 Plus
Dere\GG22850-PA 412 GG22850-PA 25..412 55..446 1144 53.4 Plus
Dere\GG22849-PA 429 GG22849-PA 28..412 50..442 886 42.7 Plus
Dere\GG16380-PA 459 GG16380-PA 20..436 33..445 560 31.8 Plus
Dere\GG17052-PA 409 GG17052-PA 20..397 50..445 546 31.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 05:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21216-PA 431 GH21216-PA 5..431 7..446 1122 48.8 Plus
Dgri\GH21215-PA 446 GH21215-PA 51..430 55..442 852 40.7 Plus
Dgri\GH21214-PA 428 GH21214-PA 39..421 47..439 840 41.2 Plus
Dgri\GH18543-PA 416 GH18543-PA 55..407 86..445 585 32.8 Plus
Dgri\GH23996-PA 455 GH23996-PA 48..432 54..445 534 33.1 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 05:46:25
Subject Length Description Subject Range Query Range Score Percent Strand
yellow-e2-PB 435 CG17044-PB 1..435 12..446 2342 100 Plus
yellow-d2-PA 412 CG9891-PA 25..411 55..445 1123 53.3 Plus
yellow-d-PA 432 CG9889-PA 5..416 9..442 872 40.3 Plus
yellow-e3-PA 409 CG17045-PA 27..397 57..445 552 32.1 Plus
yellow-h-PA 463 CG1629-PA 55..440 54..445 513 30.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 05:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20502-PA 429 GI20502-PA 40..428 55..445 1113 52.3 Plus
Dmoj\GI20501-PA 443 GI20501-PA 43..427 50..442 901 42 Plus
Dmoj\GI23242-PA 408 GI23242-PA 52..401 86..445 563 33.2 Plus
Dmoj\GI11002-PA 470 GI11002-PA 6..446 10..445 561 31.7 Plus
Dmoj\GI13248-PA 432 GI13248-PA 25..430 56..445 460 27.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 05:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23986-PA 429 GL23986-PA 6..426 25..445 1799 76 Plus
Dper\GL17571-PA 418 GL17571-PA 31..418 55..446 1106 50.9 Plus
Dper\GL17570-PA 434 GL17570-PA 29..417 46..442 883 42.3 Plus
Dper\GL23987-PA 409 GL23987-PA 43..395 86..445 579 34.7 Plus
Dper\GL18156-PA 466 GL18156-PA 57..443 54..445 512 29.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 05:46:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14291-PB 426 GA14291-PB 3..423 25..445 1808 77 Plus
Dpse\GA22105-PA 422 GA22105-PA 35..422 55..446 1105 50.9 Plus
Dpse\GA22103-PA 434 GA22103-PA 29..417 46..442 883 42.3 Plus
Dpse\GA14292-PA 409 GA14292-PA 43..395 86..445 579 34.7 Plus
Dpse\GA27858-PA 427 GA27858-PA 18..404 54..445 512 29.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 05:46:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25936-PA 426 GM25936-PA 10..426 30..446 2192 97.1 Plus
Dsec\GM16008-PA 412 GM16008-PA 25..411 55..445 1125 52.6 Plus
Dsec\GM16007-PA 430 GM16007-PA 26..414 46..442 900 42.8 Plus
Dsec\GM25937-PA 409 GM25937-PA 16..397 46..445 555 31.5 Plus
Dsec\GM15882-PA 438 GM15882-PA 31..436 56..445 429 26.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 05:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20498-PA 426 GD20498-PA 10..426 30..446 2212 98.1 Plus
Dsim\GD11759-PA 412 GD11759-PA 25..411 55..445 1140 53.6 Plus
Dsim\GD11758-PA 432 GD11758-PA 28..416 46..442 902 42.8 Plus
Dsim\GD20499-PA 387 GD20499-PA 16..344 46..391 463 30.9 Plus
Dsim\GD23989-PA 438 GD23989-PA 31..436 56..445 429 26.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 05:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22352-PA 430 GJ22352-PA 34..430 48..446 1111 50.5 Plus
Dvir\GJ22351-PA 453 GJ22351-PA 46..437 41..442 891 41 Plus
Dvir\GJ10739-PA 415 GJ10739-PA 26..405 50..445 617 33.2 Plus
Dvir\GJ14923-PA 455 GJ14923-PA 44..432 54..445 563 33.3 Plus
Dvir\GJ11869-PA 435 GJ11869-PA 28..433 56..445 444 27.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 05:46:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13343-PA 420 GK13343-PA 25..415 55..445 1673 74.7 Plus
Dwil\GK23285-PA 422 GK23285-PA 7..422 18..446 1128 49.8 Plus
Dwil\GK23284-PA 446 GK23284-PA 46..430 50..442 934 43.8 Plus
Dwil\GK13344-PA 401 GK13344-PA 42..387 86..445 551 34.3 Plus
Dwil\GK13672-PA 468 GK13672-PA 57..434 54..436 521 32.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 05:46:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24439-PA 440 GE24439-PA 13..440 19..446 2175 93 Plus
Dyak\GE14285-PA 412 GE14285-PA 25..412 55..446 1150 53.2 Plus
Dyak\GE14284-PA 430 GE14284-PA 30..414 50..442 878 42.2 Plus
Dyak\GE24440-PA 411 GE24440-PA 20..399 50..445 556 31.8 Plus
Dyak\GE14541-PA 463 GE14541-PA 56..440 55..445 537 31.5 Plus