Clone MIP14694 Report

Search the DGRC for MIP14694

Clone and Library Details

Library:MIP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by:
Date Registered:2008-10-08
Comments:
Original Plate Number:146
Well:94
Vector:pOT2|pOTB7_DraIII
Associated Gene/TranscriptArp53D-RA
Protein status:MIP14694.pep: wuzgold
Sequenced Size:1394

Clone Sequence Records

MIP14694.complete Sequence

1394 bp assembled on 2011-03-08

GenBank Submission: BT126125.1

> MIP14694.complete
GAACACAGCACACAACATTACATTTCAAATACCTTCCCGAATCAAAATCG
ATATAACAAATAAACGGGCACAGAACATTCTTCACAAATATCTACATTTA
CCAACCTCTCCTGGAAACATGAGCAGCGAGGTAGATAGTAATTCACACCA
CGCCGCAGTGGTTATTGACAACGGCTCTGGAGTATGTAAGGCTGGATTCT
CCCCAGAAGATACTCCCCGTGCTGTCTTCCCGTCGATTGTGGGCAGACCT
CGTCACCTGAACGTCCTGCTGGATTCCGTGATCGGTGATAGTGTTATTGG
CGAGGCGGCAGCCCGAAAAAGGGGAATACTAACCCTAAAGTATCCCATCG
AGCACGGAATGGTCAAGAACTGGGATGAAATGGAGATGGTTTGGCAGCAC
ACGTACGAGCTCTTGCGGGCGGATCCAATGGATTTGCCGGCTCTACTCAC
CGAAGCCCCACTGAATCCGAAGAAGAATAGAGAGAAGATGACAGAGATTA
TGTTCGAACACTTTCAGGTGCCAGCTTTTTATGTAGCAGTTCAGGCTGTG
CTCTCACTTTACGCCACCGGGCGTACTGTGGGCATTGTGGTGGACTCGGG
TGATGGTGTGACGCACACGGTACCGATCTACGAAGGATTTGCCCTGCCCC
ACGCCTGTGTACGAGTTGATCTGGCCGGCAGGGACCTCACCGATTATCTA
TGCAAGCTGCTTCTGGAGAGGGGCGTTACAATGGGCACCTCTGCTGAACG
GGAAATCGTGCGTGAAATCAAGGAGAAACTCTGCTATGTGTCAATGAACT
ATGCCAAGGAAATGGATCTCCACGGAAAGGTGGAAACCTATGAGCTGCCA
GATGGGCAGAAAATCGTTTTGGGCTGCGAGAGATTCCGCTGCCCGGAGGC
TCTCTTCCAACCCAGTTTGCTGGGTCAGGAGGTGATGGGCATCCACGAGG
CCACCCATCACTCGATAACCAACTGCGACATGGATCTGCGAAAGGATATG
TATGCGAACATTGTTCTCTCTGGCGGTACGACCATGTTTCGTAACATCGA
GCATAGATTCCTGCAAGACCTAACCGAAATGGCTCCACCATCCATCCGAA
TCAAGGTTAACGCTAGTCCAGACCGCAGATTCTCCGTTTGGACGGGTGGT
TCCGTCTTGGCCTCACTCACGAGCTTCCAAAACATGTGGATCGACAGCTT
GGAGTACGAAGAAGTTGGTTCCGCCATAGTCCATCGAAAGTGTTTTTAGT
TAAGGAGGGTGTTCAAATATTCGTTATGAGCAATGATTATTATATATTTT
CTATTTGCTAATGAATGTAATTTCTTAAACAAATCTAGTCGATATAAAAT
AAACAAAACTGGGGGTTACCTACACAAAAAAAAAAAAAAAAAAA

MIP14694.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2014-11-27 16:56:02
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 12661613..12662886 102..1375 6295 99.6 Plus
chr2R 21145070 chr2R 12661456..12661559 1..101 440 97.1 Plus
chr3R 27901430 chr3R 11265544..11265791 449..696 265 73.8 Plus
chr3R 27901430 chr3R 9252174..9252380 449..655 255 74.9 Plus
chrX 22417052 chrX 5795373..5795579 449..655 210 73.4 Plus
chr3R 27901430 chr3R 11265984..11266144 877..1037 205 75.2 Plus
chr3L 24539361 chr3L 21974696..21974809 542..655 195 78.1 Plus
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
Arp53D-RB 1236 CG5409-PB 6..1236 19..1249 6155 100 Plus
Act88F-RA 1131 CG5178-PA 319..566 449..696 265 73.8 Plus
Act87E-RC 1131 CG18290-PC 319..525 449..655 255 74.9 Plus
Act88F-RA 1131 CG5178-PA 759..919 877..1037 205 75.2 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
Arp53D-RB 1378 CG5409-RB 1..1378 1..1375 6810 99.8 Plus
Act88F-RA 1595 CG5178-RA 413..660 449..696 265 73.8 Plus
Act87E-RC 1853 CG18290-RC 400..606 449..655 255 74.9 Plus
Act88F-RA 1595 CG5178-RA 853..1013 877..1037 205 75.2 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-27 16:56:01
Subject Length Description Subject Range Query Range Score Percent Strand
Arp53D-PB 411 CG5409-PB 3..411 20..1246 2144 100 Plus
Act5C-PE 376 CG4027-PE 7..376 152..1246 1281 64.9 Plus
Act5C-PD 376 CG4027-PD 7..376 152..1246 1281 64.9 Plus
Act5C-PC 376 CG4027-PC 7..376 152..1246 1281 64.9 Plus
Act5C-PA 376 CG4027-PA 7..376 152..1246 1281 64.9 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-27 16:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16774403..16775681 102..1380 6395 100 Plus
2R 25286936 2R 16774246..16774349 1..101 440 97.1 Plus
3R 32079331 3R 15440934..15441181 449..696 265 73.8 Plus
3R 32079331 3R 13426922..13427128 449..655 255 74.9 Plus
X 23542271 X 5903016..5903222 449..655 210 73.4 Plus
3R 32079331 3R 15441374..15441534 877..1037 205 75.2 Plus
X 23542271 X 5902723..5902821 159..257 195 79.8 Plus
3L 28110227 3L 21985762..21985875 542..655 195 78.1 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:08:24
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 16775602..16776880 102..1380 6395 100 Plus
2R 25260384 2R 16775445..16775548 1..101 450 97.1 Plus
3R 31820162 3R 15181858..15182012 542..696 235 76.7 Plus
3R 31820162 3R 13167846..13167959 542..655 210 78.9 Plus
X 23527363 X 5910821..5910919 159..257 195 79.7 Plus
X 23527363 X 5911207..5911320 542..655 195 78 Plus
3L 28103327 3L 21978862..21978975 542..655 195 78 Plus
2R 25260384 2R 20946414..20946527 542..655 180 77.1 Plus
2R 25260384 2R 20946201..20946271 332..402 160 81.6 Plus
3R 31820162 3R 15181651..15181715 338..402 160 83 Plus
3L 28103327 3L 21978655..21978719 338..402 160 83 Plus
3R 31820162 3R 15182266..15182365 938..1037 155 77 Plus
3L 28103327 3L 21979270..21979369 938..1037 155 77 Plus
X 23527363 X 5911401..5911454 736..789 150 85.1 Plus
3R 31820162 3R 13167633..13167703 332..402 145 80.2 Plus
3R 31820162 3R 13167453..13167544 152..243 145 77.1 Plus
Blast to na_te.dros performed on 2014-11-27 16:55:56 has no hits.

MIP14694.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2014-11-27 17:26:46 Download gff for MIP14694.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 12661613..12662886 102..1375 99   Plus
chr2R 12661456..12661559 1..101 97 -> Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-08 15:45:04 Download gff for MIP14694.complete
Subject Subject Range Query Range Percent Splice Strand
Arp53D-RA 1..1131 119..1249 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:54:21 Download gff for MIP14694.complete
Subject Subject Range Query Range Percent Splice Strand
Arp53D-RB 1..1236 17..1249 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:26:46 Download gff for MIP14694.complete
Subject Subject Range Query Range Percent Splice Strand
Arp53D-RB 1..1236 17..1249 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-08 15:45:03 Download gff for MIP14694.complete
Subject Subject Range Query Range Percent Splice Strand
Arp53D-RA 1..1316 58..1373 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:54:21 Download gff for MIP14694.complete
Subject Subject Range Query Range Percent Splice Strand
Arp53D-RB 1..1378 1..1375 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:26:46 Download gff for MIP14694.complete
Subject Subject Range Query Range Percent Splice Strand
Arp53D-RB 1..1378 1..1375 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-27 17:26:46 Download gff for MIP14694.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16774403..16775676 102..1375 100   Plus
2R 16774246..16774349 1..101 97 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:54:21 Download gff for MIP14694.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 12661908..12663181 102..1375 100   Plus
arm_2R 12661751..12661854 1..101 97 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 20:00:57 Download gff for MIP14694.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16775602..16776875 102..1375 100   Plus
2R 16775445..16775548 1..101 97 -> Plus

MIP14694.hyp Sequence

Translation from 0 to 1248

> MIP14694.hyp
NTAHNMSTFQIPSRIKIDITNKRAQNILHKYLHLPTSPGNMSSEVDSNSH
HAAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVI
GEAAARKRGILTLKYPIEHGMVKNWDEMEMVWQHTYELLRADPMDLPALL
TEAPLNPKKNREKMTEIMFEHFQVPAFYVAVQAVLSLYATGRTVGIVVDS
GDGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLERGVTMGTSAE
REIVREIKEKLCYVSMNYAKEMDLHGKVETYELPDGQKIVLGCERFRCPE
ALFQPSLLGQEVMGIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNI
EHRFLQDLTEMAPPSIRIKVNASPDRRFSVWTGGSVLASLTSFQNMWIDS
LEYEEVGSAIVHRKCF*

MIP14694.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:03:32
Subject Length Description Subject Range Query Range Score Percent Strand
Arp53D-PB 411 CG5409-PB 1..411 6..416 2153 100 Plus
Act5C-PE 376 CG4027-PE 7..376 52..416 1281 64.9 Plus
Act5C-PD 376 CG4027-PD 7..376 52..416 1281 64.9 Plus
Act5C-PC 376 CG4027-PC 7..376 52..416 1281 64.9 Plus
Act5C-PA 376 CG4027-PA 7..376 52..416 1281 64.9 Plus

MIP14694.pep Sequence

Translation from 1 to 1248

> MIP14694.pep
NTAHNITFQIPSRIKIDITNKRAQNILHKYLHLPTSPGNMSSEVDSNSHH
AAVVIDNGSGVCKAGFSPEDTPRAVFPSIVGRPRHLNVLLDSVIGDSVIG
EAAARKRGILTLKYPIEHGMVKNWDEMEMVWQHTYELLRADPMDLPALLT
EAPLNPKKNREKMTEIMFEHFQVPAFYVAVQAVLSLYATGRTVGIVVDSG
DGVTHTVPIYEGFALPHACVRVDLAGRDLTDYLCKLLLERGVTMGTSAER
EIVREIKEKLCYVSMNYAKEMDLHGKVETYELPDGQKIVLGCERFRCPEA
LFQPSLLGQEVMGIHEATHHSITNCDMDLRKDMYANIVLSGGTTMFRNIE
HRFLQDLTEMAPPSIRIKVNASPDRRFSVWTGGSVLASLTSFQNMWIDSL
EYEEVGSAIVHRKCF*

MIP14694.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2014-11-28 08:56:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11406-PA 388 GF11406-PA 1..388 40..415 1622 77.7 Plus
Dana\GF13827-PA 376 GF13827-PA 7..376 51..415 1329 64.6 Plus
Dana\GF17602-PA 376 GF17602-PA 7..376 51..415 1323 64.3 Plus
Dana\GF12208-PA 376 GF12208-PA 7..376 51..415 1321 64.3 Plus
Dana\GF18300-PA 376 GF18300-PA 7..376 51..415 1320 64.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2014-11-28 08:56:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20626-PA 376 GG20626-PA 1..376 40..415 1908 94.1 Plus
Dere\GG18797-PA 376 GG18797-PA 7..376 51..415 1329 64.9 Plus
Dere\GG10840-PA 376 GG10840-PA 7..376 51..415 1328 64.6 Plus
Dere\GG19688-PA 376 GG19688-PA 7..376 51..415 1323 64.3 Plus
Dere\GG22068-PA 376 GG22068-PA 7..376 51..415 1321 64.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2014-11-28 08:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23086-PA 379 GH23086-PA 11..379 52..415 1408 68.6 Plus
Dgri\GH20408-PA 376 GH20408-PA 7..376 51..415 1330 64.9 Plus
Dgri\GH24372-PA 376 GH24372-PA 7..376 51..415 1329 64.9 Plus
Dgri\GH19045-PA 376 GH19045-PA 7..376 51..415 1323 64.3 Plus
Dgri\GH19077-PA 376 GH19077-PA 7..376 51..415 1321 64.9 Plus
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 08:56:38
Subject Length Description Subject Range Query Range Score Percent Strand
Arp53D-PB 411 CG5409-PB 3..411 7..415 2144 100 Plus
Act5C-PE 376 CG4027-PE 7..376 51..415 1281 64.9 Plus
Act5C-PD 376 CG4027-PD 7..376 51..415 1281 64.9 Plus
Act5C-PC 376 CG4027-PC 7..376 51..415 1281 64.9 Plus
Act5C-PA 376 CG4027-PA 7..376 51..415 1281 64.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2014-11-28 08:56:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21151-PA 410 GI21151-PA 4..410 8..415 1514 67.8 Plus
Dmoj\GI19595-PA 376 GI19595-PA 7..376 51..415 1331 64.9 Plus
Dmoj\GI15312-PA 376 GI15312-PA 7..376 51..415 1329 64.9 Plus
Dmoj\GI24339-PA 376 GI24339-PA 7..376 51..415 1323 64.3 Plus
Dmoj\GI23222-PA 376 GI23222-PA 7..376 51..415 1321 64.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2014-11-28 08:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11798-PA 377 GL11798-PA 3..377 50..415 1346 64.6 Plus
Dper\GL17787-PA 376 GL17787-PA 7..376 51..415 1330 64.9 Plus
Dper\GL14888-PA 376 GL14888-PA 7..376 51..415 1329 64.9 Plus
Dper\GL17061-PA 376 GL17061-PA 7..376 51..415 1321 64.3 Plus
Dper\GL26327-PA 376 GL26327-PA 2..376 46..415 1314 63.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2014-11-28 08:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18861-PA 377 GA18861-PA 3..377 50..415 1365 65.4 Plus
Dpse\GA24908-PB 376 GA24908-PB 7..376 51..415 1330 64.9 Plus
Dpse\GA24908-PA 376 GA24908-PA 7..376 51..415 1330 64.9 Plus
Dpse\GA17886-PA 376 GA17886-PA 7..376 51..415 1329 64.9 Plus
Dpse\GA14877-PB 376 GA14877-PB 7..376 51..415 1323 64.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2014-11-28 08:56:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21720-PA 376 GM21720-PA 1..376 40..415 1944 95.2 Plus
Dsec\GM12447-PA 376 GM12447-PA 7..376 51..415 1329 64.9 Plus
Dsec\GM16492-PA 376 GM16492-PA 7..376 51..415 1328 64.6 Plus
Dsec\GM24109-PA 376 GM24109-PA 7..376 51..415 1306 63.5 Plus
Dsec\GM22426-PA 376 GM22426-PA 7..376 51..415 1299 63.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2014-11-28 08:56:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11215-PA 376 GD11215-PA 1..376 40..415 1943 95.5 Plus
Dsim\GD16764-PA 376 GD16764-PA 7..376 51..415 1329 64.9 Plus
Dsim\GD10342-PA 376 GD10342-PA 7..376 51..415 1328 64.6 Plus
Dsim\GD18909-PA 376 GD18909-PA 7..376 51..415 1323 64.3 Plus
Dsim\GD11548-PA 376 GD11548-PA 7..376 51..415 1321 64.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2014-11-28 08:56:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20999-PA 377 GJ20999-PA 9..377 52..415 1474 73.2 Plus
Dvir\GJ18395-PA 376 GJ18395-PA 7..376 51..415 1331 64.9 Plus
Dvir\GJ14747-PA 376 GJ14747-PA 7..376 51..415 1329 64.9 Plus
Dvir\ActE1-PA 376 GJ10425-PA 7..376 51..415 1323 64.3 Plus
Dvir\ActE2-PA 376 GJ22881-PA 7..376 51..415 1321 64.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2014-11-28 08:56:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15913-PA 378 GK15913-PA 6..378 45..415 1417 69.2 Plus
Dwil\GK20124-PA 376 GK20124-PA 7..376 51..415 1329 64.9 Plus
Dwil\GK21751-PA 376 GK21751-PA 7..376 51..415 1328 64.6 Plus
Dwil\GK13943-PA 376 GK13943-PA 7..376 51..415 1323 64.3 Plus
Dwil\GK23336-PA 376 GK23336-PA 7..376 51..415 1321 64.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2014-11-28 08:56:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11816-PA 376 GE11816-PA 1..376 40..415 1917 93.6 Plus
Dyak\Act57B-PA 376 GE17558-PA 7..376 51..415 1329 64.9 Plus
Dyak\GE19434-PA 376 GE19434-PA 7..376 51..415 1327 64.6 Plus
Dyak\GE26273-PA 376 GE26273-PA 7..376 51..415 1323 64.3 Plus
Dyak\GE12149-PA 376 GE12149-PA 7..376 51..415 1321 64.3 Plus